Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B5U0

Protein Details
Accession A0A376B5U0   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-42KEIQRNLTRKSRLKKQYLKALKEEHydrophilic
81-128LKYEEKKKLKQERLYKKRQDREFKREKELNRIKEIKSKHQTKIDRREKBasic
NLS Segment(s)
PositionSequence
71-129RKVIKRQNSELKYEEKKKLKQERLYKKRQDREFKREKELNRIKEIKSKHQTKIDRREKL
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MPPKKSLNAKKFTREYKLKEIQRNLTRKSRLKKQYLKALKEEGYAIPQNTESDEHLDGKNTATAKLTGRDRKVIKRQNSELKYEEKKKLKQERLYKKRQDREFKREKELNRIKEIKSKHQTKIDRREKLAQRTKTGQPLMGPRIEDLLNKIKNDDTYTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.76
4 0.78
5 0.77
6 0.78
7 0.78
8 0.78
9 0.78
10 0.78
11 0.74
12 0.74
13 0.74
14 0.73
15 0.74
16 0.75
17 0.75
18 0.78
19 0.82
20 0.81
21 0.83
22 0.84
23 0.8
24 0.75
25 0.71
26 0.62
27 0.53
28 0.47
29 0.37
30 0.32
31 0.29
32 0.24
33 0.19
34 0.17
35 0.16
36 0.16
37 0.16
38 0.12
39 0.13
40 0.14
41 0.16
42 0.15
43 0.16
44 0.15
45 0.14
46 0.16
47 0.13
48 0.12
49 0.11
50 0.13
51 0.13
52 0.18
53 0.24
54 0.27
55 0.29
56 0.35
57 0.37
58 0.44
59 0.52
60 0.56
61 0.57
62 0.59
63 0.64
64 0.67
65 0.66
66 0.61
67 0.54
68 0.52
69 0.51
70 0.49
71 0.51
72 0.48
73 0.51
74 0.56
75 0.64
76 0.66
77 0.68
78 0.72
79 0.76
80 0.79
81 0.84
82 0.84
83 0.83
84 0.84
85 0.84
86 0.85
87 0.83
88 0.83
89 0.84
90 0.79
91 0.78
92 0.75
93 0.69
94 0.69
95 0.69
96 0.64
97 0.63
98 0.63
99 0.56
100 0.56
101 0.58
102 0.58
103 0.59
104 0.6
105 0.58
106 0.63
107 0.7
108 0.73
109 0.8
110 0.8
111 0.77
112 0.75
113 0.78
114 0.78
115 0.79
116 0.79
117 0.74
118 0.71
119 0.69
120 0.7
121 0.69
122 0.62
123 0.54
124 0.49
125 0.5
126 0.48
127 0.45
128 0.4
129 0.31
130 0.32
131 0.31
132 0.27
133 0.25
134 0.29
135 0.3
136 0.3
137 0.31
138 0.31
139 0.33