Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B308

Protein Details
Accession A0A376B308    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29HTAHNQTKKAHRNGIKKPKTYKYHydrophilic
NLS Segment(s)
PositionSequence
14-62KKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAKRAAKK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTKKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAKRAAKKSQQAHQNTPKHQNTSRYVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.76
4 0.74
5 0.73
6 0.76
7 0.82
8 0.81
9 0.79
10 0.8
11 0.79
12 0.8
13 0.77
14 0.76
15 0.75
16 0.73
17 0.72
18 0.68
19 0.63
20 0.62
21 0.61
22 0.61
23 0.56
24 0.57
25 0.58
26 0.62
27 0.64
28 0.61
29 0.65
30 0.59
31 0.65
32 0.6
33 0.6
34 0.56
35 0.51
36 0.47
37 0.39
38 0.35
39 0.27
40 0.24
41 0.18
42 0.18
43 0.22
44 0.27
45 0.33
46 0.36
47 0.39
48 0.47
49 0.52
50 0.56
51 0.6
52 0.61
53 0.64
54 0.7
55 0.74
56 0.72
57 0.76
58 0.75
59 0.73
60 0.71
61 0.7