Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A2Q866

Protein Details
Accession A2Q866    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
355-383LSVTRGKGFTKEKNKKKRGSYRGGPIDISHydrophilic
NLS Segment(s)
PositionSequence
138-146KKPAAPAAK
361-374KGFTKEKNKKKRGS
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG ang:ANI_1_2414014  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MAGQKSKQAKPAKASKSKETPAPPAQLVAALSAFLSESGFSKTKEAFTKELASKSIDSDAKNVPSLLELYQSWEKSSEKSSGSSSSDSDSDSESESGSESDSESSDSSSDESSDSDVEMNDKSESDSDSDSDDEEEKKKPAAPAAKSQGTKRKAESSSSESDSESEADEAPKSKKTKVTSAKEESSDSDSSDSESDSSSSSSESEESSDSDSSSDDSSSSSSESDSDSDSDSDSDSSSDDEDDKKADKKALKAATKTPLPPSESSSSGSSPSSSSDSDTTGTVSNSDSAPKEQSKSAQTSYSSSASPAPGNGPQKKKHTGARPTPLAQLSELPTDHLLSNDYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.76
5 0.75
6 0.71
7 0.7
8 0.67
9 0.67
10 0.58
11 0.5
12 0.45
13 0.39
14 0.33
15 0.25
16 0.18
17 0.11
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.05
24 0.06
25 0.12
26 0.14
27 0.15
28 0.19
29 0.21
30 0.26
31 0.32
32 0.36
33 0.34
34 0.36
35 0.44
36 0.45
37 0.46
38 0.42
39 0.38
40 0.34
41 0.33
42 0.36
43 0.31
44 0.28
45 0.29
46 0.32
47 0.32
48 0.32
49 0.3
50 0.23
51 0.21
52 0.21
53 0.17
54 0.15
55 0.12
56 0.17
57 0.22
58 0.22
59 0.22
60 0.23
61 0.24
62 0.23
63 0.26
64 0.26
65 0.22
66 0.24
67 0.26
68 0.28
69 0.3
70 0.29
71 0.27
72 0.24
73 0.23
74 0.22
75 0.2
76 0.17
77 0.14
78 0.15
79 0.14
80 0.12
81 0.11
82 0.11
83 0.1
84 0.09
85 0.08
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1
112 0.11
113 0.11
114 0.1
115 0.12
116 0.12
117 0.11
118 0.12
119 0.12
120 0.13
121 0.14
122 0.16
123 0.15
124 0.16
125 0.19
126 0.19
127 0.23
128 0.29
129 0.3
130 0.36
131 0.43
132 0.48
133 0.47
134 0.51
135 0.54
136 0.5
137 0.5
138 0.44
139 0.45
140 0.4
141 0.42
142 0.42
143 0.39
144 0.4
145 0.4
146 0.38
147 0.3
148 0.28
149 0.26
150 0.21
151 0.15
152 0.11
153 0.09
154 0.08
155 0.09
156 0.1
157 0.11
158 0.16
159 0.17
160 0.2
161 0.25
162 0.27
163 0.37
164 0.44
165 0.5
166 0.54
167 0.58
168 0.58
169 0.55
170 0.52
171 0.44
172 0.39
173 0.31
174 0.23
175 0.18
176 0.15
177 0.14
178 0.13
179 0.11
180 0.07
181 0.07
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.07
190 0.07
191 0.07
192 0.07
193 0.08
194 0.1
195 0.09
196 0.09
197 0.09
198 0.09
199 0.09
200 0.08
201 0.08
202 0.06
203 0.06
204 0.07
205 0.07
206 0.07
207 0.07
208 0.06
209 0.07
210 0.07
211 0.08
212 0.08
213 0.09
214 0.09
215 0.09
216 0.09
217 0.09
218 0.09
219 0.08
220 0.07
221 0.07
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.08
228 0.09
229 0.1
230 0.12
231 0.15
232 0.16
233 0.21
234 0.23
235 0.25
236 0.33
237 0.4
238 0.43
239 0.43
240 0.47
241 0.49
242 0.49
243 0.48
244 0.45
245 0.41
246 0.39
247 0.37
248 0.37
249 0.34
250 0.32
251 0.32
252 0.29
253 0.25
254 0.23
255 0.22
256 0.17
257 0.15
258 0.15
259 0.15
260 0.13
261 0.15
262 0.14
263 0.15
264 0.15
265 0.15
266 0.15
267 0.13
268 0.13
269 0.11
270 0.11
271 0.11
272 0.1
273 0.12
274 0.12
275 0.13
276 0.18
277 0.2
278 0.22
279 0.23
280 0.27
281 0.3
282 0.34
283 0.34
284 0.33
285 0.32
286 0.33
287 0.35
288 0.32
289 0.27
290 0.23
291 0.23
292 0.21
293 0.2
294 0.17
295 0.16
296 0.21
297 0.29
298 0.36
299 0.41
300 0.46
301 0.53
302 0.58
303 0.61
304 0.63
305 0.65
306 0.68
307 0.71
308 0.74
309 0.73
310 0.69
311 0.69
312 0.63
313 0.54
314 0.45
315 0.39
316 0.32
317 0.28
318 0.26
319 0.22
320 0.2
321 0.21
322 0.2
323 0.16
324 0.15
325 0.13
326 0.15
327 0.14
328 0.13
329 0.11
330 0.12
331 0.13
332 0.13
333 0.12
334 0.12
335 0.13
336 0.14
337 0.16
338 0.16
339 0.14
340 0.14
341 0.16
342 0.19
343 0.24
344 0.24
345 0.23
346 0.26
347 0.27
348 0.33
349 0.38
350 0.44
351 0.49
352 0.58
353 0.68
354 0.76
355 0.85
356 0.86
357 0.9
358 0.91
359 0.9
360 0.9
361 0.89
362 0.88
363 0.88
364 0.82
365 0.72
366 0.62
367 0.57
368 0.48
369 0.42
370 0.34
371 0.26
372 0.23