Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B306

Protein Details
Accession A0A376B306   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-37PGTACIKPIKNKQTQIEKTKDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009016  Fe_hydrogenase  
IPR004108  Fe_hydrogenase_lsu_C  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
Pfam View protein in Pfam  
PF02906  Fe_hyd_lg_C  
Amino Acid Sequences MSAILSEEDLNDFISPGTACIKPIKNKQTQIEKTKDNELEVGKEDVDLEKVSISLQDCLACSGCITSSEELLLSKQSAKVFLDSWMNENSIKNQDRILAVSISPQCRISLSKYFNDITVSEFDKRFLTIMHEKFGATYIVGTQIGREIAIEQMIDKLDKCATPTGALPKLSSVCPGFVLYCEKTNPTLLPHLLNVKSPQQITGSVLKNGLRSNKIYHLSIMPCFDKKLEASREDGENEVDCVITPKEVVNMFADLNIDFNAYPVVLDKDAEVFYKKFNPSMLKVFSDPVRSWCSNEGSSSGGYAYQYILHEFKKYTENNTSDELYSIETVHGKNNDIKEYRLMKNGEIVKCSCELYGFRNIQNMVRKFTLKSPANKINKKLVKLNTRLNRLKGTTTNTATSGVKVDPFKSDFIEVMACPSGCINGGGLIFPEQTDNNAKRRTLYIKELNKRYEEQLKNLPLIVKDDINKHDKHAYYEYTFKSVKDSKDVGDISSDNNNLNANPLDVASKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.13
5 0.13
6 0.15
7 0.22
8 0.3
9 0.37
10 0.47
11 0.56
12 0.62
13 0.69
14 0.77
15 0.8
16 0.82
17 0.83
18 0.81
19 0.78
20 0.72
21 0.74
22 0.67
23 0.57
24 0.53
25 0.46
26 0.41
27 0.37
28 0.35
29 0.26
30 0.23
31 0.22
32 0.18
33 0.17
34 0.14
35 0.12
36 0.1
37 0.1
38 0.1
39 0.12
40 0.13
41 0.12
42 0.13
43 0.14
44 0.14
45 0.17
46 0.17
47 0.14
48 0.13
49 0.12
50 0.11
51 0.11
52 0.14
53 0.13
54 0.13
55 0.13
56 0.13
57 0.13
58 0.13
59 0.13
60 0.11
61 0.13
62 0.16
63 0.16
64 0.19
65 0.2
66 0.21
67 0.2
68 0.22
69 0.27
70 0.24
71 0.26
72 0.25
73 0.25
74 0.25
75 0.25
76 0.26
77 0.29
78 0.3
79 0.28
80 0.27
81 0.29
82 0.28
83 0.29
84 0.28
85 0.2
86 0.17
87 0.23
88 0.27
89 0.26
90 0.26
91 0.24
92 0.22
93 0.22
94 0.25
95 0.23
96 0.27
97 0.31
98 0.33
99 0.37
100 0.37
101 0.37
102 0.36
103 0.31
104 0.24
105 0.23
106 0.23
107 0.22
108 0.22
109 0.22
110 0.2
111 0.2
112 0.18
113 0.15
114 0.19
115 0.24
116 0.26
117 0.28
118 0.28
119 0.27
120 0.27
121 0.27
122 0.21
123 0.11
124 0.1
125 0.08
126 0.09
127 0.1
128 0.09
129 0.08
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.06
139 0.07
140 0.08
141 0.08
142 0.08
143 0.09
144 0.1
145 0.11
146 0.12
147 0.13
148 0.14
149 0.15
150 0.17
151 0.22
152 0.24
153 0.25
154 0.23
155 0.22
156 0.24
157 0.23
158 0.23
159 0.17
160 0.13
161 0.14
162 0.14
163 0.12
164 0.12
165 0.17
166 0.15
167 0.16
168 0.17
169 0.17
170 0.18
171 0.19
172 0.19
173 0.16
174 0.19
175 0.18
176 0.18
177 0.18
178 0.23
179 0.22
180 0.23
181 0.22
182 0.22
183 0.24
184 0.23
185 0.23
186 0.19
187 0.19
188 0.2
189 0.25
190 0.23
191 0.21
192 0.23
193 0.23
194 0.23
195 0.25
196 0.26
197 0.21
198 0.21
199 0.23
200 0.28
201 0.29
202 0.28
203 0.27
204 0.26
205 0.26
206 0.25
207 0.25
208 0.2
209 0.18
210 0.18
211 0.17
212 0.15
213 0.14
214 0.2
215 0.21
216 0.21
217 0.24
218 0.25
219 0.27
220 0.26
221 0.26
222 0.19
223 0.14
224 0.13
225 0.1
226 0.08
227 0.06
228 0.07
229 0.06
230 0.06
231 0.06
232 0.05
233 0.08
234 0.08
235 0.1
236 0.09
237 0.1
238 0.1
239 0.1
240 0.1
241 0.07
242 0.08
243 0.07
244 0.06
245 0.05
246 0.05
247 0.05
248 0.04
249 0.04
250 0.04
251 0.06
252 0.05
253 0.05
254 0.05
255 0.07
256 0.08
257 0.08
258 0.1
259 0.09
260 0.1
261 0.16
262 0.17
263 0.16
264 0.19
265 0.22
266 0.23
267 0.28
268 0.29
269 0.25
270 0.25
271 0.26
272 0.25
273 0.26
274 0.23
275 0.21
276 0.25
277 0.23
278 0.24
279 0.26
280 0.27
281 0.24
282 0.24
283 0.21
284 0.17
285 0.16
286 0.15
287 0.11
288 0.09
289 0.08
290 0.08
291 0.07
292 0.07
293 0.07
294 0.09
295 0.11
296 0.11
297 0.13
298 0.13
299 0.15
300 0.2
301 0.21
302 0.25
303 0.3
304 0.32
305 0.33
306 0.35
307 0.35
308 0.27
309 0.27
310 0.22
311 0.15
312 0.14
313 0.11
314 0.09
315 0.1
316 0.1
317 0.13
318 0.14
319 0.15
320 0.18
321 0.21
322 0.26
323 0.25
324 0.26
325 0.3
326 0.35
327 0.36
328 0.38
329 0.37
330 0.31
331 0.37
332 0.43
333 0.37
334 0.34
335 0.32
336 0.27
337 0.27
338 0.28
339 0.21
340 0.15
341 0.15
342 0.16
343 0.24
344 0.25
345 0.24
346 0.28
347 0.29
348 0.32
349 0.4
350 0.38
351 0.34
352 0.34
353 0.35
354 0.32
355 0.37
356 0.43
357 0.39
358 0.44
359 0.48
360 0.55
361 0.64
362 0.67
363 0.67
364 0.67
365 0.67
366 0.64
367 0.64
368 0.63
369 0.62
370 0.63
371 0.69
372 0.66
373 0.7
374 0.72
375 0.67
376 0.65
377 0.57
378 0.56
379 0.51
380 0.49
381 0.47
382 0.44
383 0.42
384 0.37
385 0.38
386 0.33
387 0.29
388 0.25
389 0.18
390 0.19
391 0.19
392 0.19
393 0.21
394 0.23
395 0.23
396 0.23
397 0.23
398 0.19
399 0.19
400 0.2
401 0.15
402 0.16
403 0.17
404 0.14
405 0.13
406 0.13
407 0.12
408 0.1
409 0.11
410 0.08
411 0.09
412 0.09
413 0.09
414 0.1
415 0.11
416 0.1
417 0.1
418 0.12
419 0.09
420 0.12
421 0.21
422 0.24
423 0.3
424 0.35
425 0.35
426 0.36
427 0.42
428 0.46
429 0.43
430 0.49
431 0.52
432 0.57
433 0.66
434 0.72
435 0.71
436 0.68
437 0.66
438 0.63
439 0.63
440 0.57
441 0.54
442 0.55
443 0.55
444 0.52
445 0.51
446 0.47
447 0.38
448 0.38
449 0.34
450 0.29
451 0.28
452 0.33
453 0.37
454 0.39
455 0.39
456 0.39
457 0.44
458 0.42
459 0.44
460 0.44
461 0.44
462 0.43
463 0.5
464 0.48
465 0.47
466 0.46
467 0.4
468 0.43
469 0.43
470 0.42
471 0.42
472 0.42
473 0.38
474 0.45
475 0.46
476 0.38
477 0.36
478 0.33
479 0.28
480 0.32
481 0.32
482 0.24
483 0.24
484 0.25
485 0.2
486 0.23
487 0.21
488 0.15
489 0.15
490 0.15