Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B1W2

Protein Details
Accession A0A376B1W2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-107KDPIALRKKAMRKANREKIKQNNFLSKLHydrophilic
NLS Segment(s)
PositionSequence
86-97RKKAMRKANREK
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFKNIIRIKSSVLFFSTKSVRLNGANTAATKIVSSCKAGTPLNLKIKKTGNDPVALEDSEYPDWLWTVLDPVVEEQALAKDPIALRKKAMRKANREKIKQNNFLSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.29
4 0.26
5 0.26
6 0.26
7 0.26
8 0.27
9 0.28
10 0.25
11 0.25
12 0.24
13 0.22
14 0.22
15 0.2
16 0.17
17 0.15
18 0.13
19 0.12
20 0.12
21 0.14
22 0.13
23 0.14
24 0.17
25 0.18
26 0.2
27 0.22
28 0.28
29 0.36
30 0.38
31 0.37
32 0.39
33 0.43
34 0.43
35 0.42
36 0.41
37 0.33
38 0.31
39 0.31
40 0.28
41 0.26
42 0.23
43 0.19
44 0.13
45 0.14
46 0.11
47 0.11
48 0.09
49 0.07
50 0.07
51 0.07
52 0.07
53 0.04
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.09
68 0.1
69 0.19
70 0.24
71 0.24
72 0.26
73 0.35
74 0.43
75 0.48
76 0.57
77 0.58
78 0.64
79 0.74
80 0.82
81 0.84
82 0.84
83 0.86
84 0.87
85 0.88
86 0.87
87 0.83