Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B3A0

Protein Details
Accession A0A376B3A0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-45QHPVKASTWKKPSSRRHKACRQILSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MDKQDILRSVASENQQHLSQHPVKASTWKKPSSRRHKACRQILSDEWKRINNTNNDAGSESTKHELTYFNLEAPPSIYPNKKYCDITGLKGHYKSPGTNLRFYNSEVYAAVIKPMIPGVDQQYLKLRGADVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.28
5 0.32
6 0.32
7 0.31
8 0.31
9 0.3
10 0.29
11 0.38
12 0.42
13 0.43
14 0.46
15 0.5
16 0.55
17 0.63
18 0.73
19 0.75
20 0.81
21 0.81
22 0.83
23 0.86
24 0.89
25 0.88
26 0.86
27 0.79
28 0.73
29 0.69
30 0.68
31 0.63
32 0.58
33 0.52
34 0.46
35 0.44
36 0.42
37 0.44
38 0.4
39 0.38
40 0.38
41 0.36
42 0.34
43 0.33
44 0.3
45 0.25
46 0.2
47 0.17
48 0.13
49 0.13
50 0.12
51 0.11
52 0.12
53 0.12
54 0.17
55 0.16
56 0.14
57 0.15
58 0.15
59 0.14
60 0.14
61 0.13
62 0.09
63 0.12
64 0.14
65 0.18
66 0.22
67 0.25
68 0.28
69 0.29
70 0.28
71 0.32
72 0.32
73 0.32
74 0.35
75 0.36
76 0.36
77 0.36
78 0.36
79 0.33
80 0.32
81 0.29
82 0.3
83 0.35
84 0.34
85 0.39
86 0.4
87 0.39
88 0.38
89 0.4
90 0.37
91 0.28
92 0.26
93 0.19
94 0.2
95 0.18
96 0.16
97 0.15
98 0.11
99 0.1
100 0.09
101 0.1
102 0.09
103 0.07
104 0.1
105 0.14
106 0.22
107 0.22
108 0.23
109 0.31
110 0.34
111 0.34
112 0.33
113 0.28
114 0.22