Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2QUU5

Protein Details
Accession A2QUU5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
137-160LTGHDKPSEKPERRKPWEKGIASKBasic
NLS Segment(s)
PositionSequence
146-158KPERRKPWEKGIA
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
KEGG ang:ANI_1_902084  -  
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSELQSSDIELFERLSSYPFGSDREFAVGLSIILGHPESPASEEEINRSDDLTLQAKCFYFSRKEKLTPPLDFSTYKAWLESASTSKSADLSSPGPTVDVPKSQEEPTYPSSFAHIVELITTGQPIPGIQQIPDTVLTGHDKPSEKPERRKPWEKGIASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.12
5 0.15
6 0.15
7 0.17
8 0.19
9 0.2
10 0.19
11 0.21
12 0.2
13 0.17
14 0.17
15 0.14
16 0.12
17 0.1
18 0.1
19 0.05
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.07
27 0.08
28 0.11
29 0.13
30 0.13
31 0.16
32 0.18
33 0.19
34 0.17
35 0.17
36 0.13
37 0.13
38 0.16
39 0.16
40 0.15
41 0.14
42 0.16
43 0.16
44 0.17
45 0.17
46 0.17
47 0.21
48 0.26
49 0.32
50 0.35
51 0.38
52 0.42
53 0.49
54 0.52
55 0.46
56 0.46
57 0.41
58 0.39
59 0.36
60 0.33
61 0.29
62 0.25
63 0.23
64 0.17
65 0.15
66 0.12
67 0.13
68 0.13
69 0.1
70 0.1
71 0.11
72 0.11
73 0.11
74 0.11
75 0.1
76 0.09
77 0.09
78 0.09
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.13
85 0.13
86 0.14
87 0.15
88 0.17
89 0.2
90 0.2
91 0.22
92 0.2
93 0.23
94 0.25
95 0.26
96 0.24
97 0.21
98 0.23
99 0.22
100 0.21
101 0.18
102 0.13
103 0.1
104 0.1
105 0.11
106 0.09
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.1
115 0.11
116 0.11
117 0.13
118 0.13
119 0.15
120 0.16
121 0.15
122 0.11
123 0.13
124 0.17
125 0.16
126 0.19
127 0.22
128 0.24
129 0.25
130 0.35
131 0.43
132 0.48
133 0.57
134 0.66
135 0.71
136 0.79
137 0.88
138 0.85
139 0.85
140 0.87