Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B128

Protein Details
Accession A0A376B128   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-153NNILPKIKKQLQQQQNKVLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020195  SWR1_Swc7  
Pfam View protein in Pfam  
PF17330  SWC7  
Amino Acid Sequences MLDTNKNKKDNPSIDQYGWDSHIILLLLQIVLHRQQYLCHKDSNLSEVECAKNPVIDDFIFNTFINHKLVKYYNIMSKNTRNSVVPTDLTLEELKQIVRSIYSRGLPQNENNDPNTLVALCNYYYFKRIDELENNILPKIKKQLQQQQNKVLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.51
4 0.43
5 0.38
6 0.33
7 0.24
8 0.17
9 0.18
10 0.14
11 0.12
12 0.09
13 0.08
14 0.07
15 0.06
16 0.07
17 0.06
18 0.08
19 0.09
20 0.1
21 0.09
22 0.14
23 0.23
24 0.3
25 0.31
26 0.32
27 0.32
28 0.34
29 0.35
30 0.35
31 0.28
32 0.21
33 0.2
34 0.2
35 0.22
36 0.19
37 0.2
38 0.17
39 0.15
40 0.15
41 0.14
42 0.13
43 0.11
44 0.12
45 0.12
46 0.13
47 0.14
48 0.14
49 0.14
50 0.12
51 0.14
52 0.15
53 0.13
54 0.12
55 0.13
56 0.14
57 0.16
58 0.17
59 0.18
60 0.22
61 0.25
62 0.27
63 0.28
64 0.32
65 0.34
66 0.33
67 0.32
68 0.27
69 0.25
70 0.27
71 0.26
72 0.21
73 0.17
74 0.18
75 0.16
76 0.17
77 0.15
78 0.12
79 0.1
80 0.1
81 0.1
82 0.08
83 0.08
84 0.07
85 0.08
86 0.09
87 0.11
88 0.14
89 0.15
90 0.18
91 0.21
92 0.25
93 0.26
94 0.3
95 0.35
96 0.37
97 0.39
98 0.37
99 0.35
100 0.31
101 0.29
102 0.26
103 0.18
104 0.13
105 0.1
106 0.11
107 0.09
108 0.11
109 0.13
110 0.13
111 0.15
112 0.16
113 0.17
114 0.18
115 0.2
116 0.25
117 0.28
118 0.34
119 0.37
120 0.4
121 0.4
122 0.37
123 0.39
124 0.33
125 0.32
126 0.34
127 0.35
128 0.38
129 0.48
130 0.58
131 0.64
132 0.74
133 0.79