Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B7R1

Protein Details
Accession A0A376B7R1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-43INIKNKTSLRAPKQRRRTFRAHydrophilic
NLS Segment(s)
PositionSequence
32-40RAPKQRRRT
84-84K
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR018260  Ribosomal_L22/L17_CS  
IPR005721  Ribosomal_L22/L17_euk/arc  
IPR036394  Ribosomal_L22/L17_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
PROSITE View protein in PROSITE  
PS00464  RIBOSOMAL_L22  
Amino Acid Sequences MRYLEQKIILFTVKRGKRCIYGINIKNKTSLRAPKQRRRTFRAHGRINKYESSPSHIELVLTEKEESIKKATDDKKVRLSSRQKGRLAAQKRIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.41
4 0.43
5 0.46
6 0.48
7 0.47
8 0.52
9 0.55
10 0.61
11 0.62
12 0.58
13 0.59
14 0.53
15 0.48
16 0.45
17 0.47
18 0.45
19 0.51
20 0.61
21 0.65
22 0.76
23 0.81
24 0.82
25 0.79
26 0.78
27 0.77
28 0.78
29 0.78
30 0.77
31 0.76
32 0.76
33 0.74
34 0.69
35 0.6
36 0.51
37 0.45
38 0.36
39 0.34
40 0.28
41 0.24
42 0.23
43 0.21
44 0.2
45 0.16
46 0.19
47 0.13
48 0.13
49 0.12
50 0.11
51 0.13
52 0.14
53 0.15
54 0.14
55 0.15
56 0.15
57 0.24
58 0.29
59 0.38
60 0.44
61 0.48
62 0.54
63 0.59
64 0.61
65 0.62
66 0.67
67 0.67
68 0.7
69 0.74
70 0.68
71 0.66
72 0.71
73 0.71
74 0.68
75 0.68