Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B3H4

Protein Details
Accession A0A376B3H4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
61-85EKNVDKLRLKRIKRILQNSKKYSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003107  HAT  
IPR011990  TPR-like_helical_dom_sf  
IPR013949  Utp6  
Gene Ontology GO:0005634  C:nucleus  
GO:0032991  C:protein-containing complex  
GO:0030515  F:snoRNA binding  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF08640  U3_assoc_6  
Amino Acid Sequences MSSKARYYLEQCIPEVDDLVEHGIFNKSEVTSIMKKRTNFEHRLNSRGSSISDYIRYVEFEKNVDKLRLKRIKRILQNSKKYSVSDYSIQHRIDFIFQRGCNKFPQDLRFWSLYLNYLKSRGNKVSYKKIHSVYNQLLRLHPTNVDVWISCAKFEYEVYANFKSCRTVFQNSLRFNPDSSKLWFEYCKFELNFVTKLITRRKVLNLINEREQEMDMLHQEKANVPDDSNEHEDGIKLPSTGDNMKDKLNELPDTDMSMLGNEETNPALRGDIALTIYDLAMKNLRQKFIEKRRGFYAVTDGNFEKELIADVNEYLYTISLDYIKLFDNFKALRRDYLITHVLHYLKTLDTIKSSKEYSSYITFIDITLNIRYMDTPSFNNTELQKSVQKYLVYKSKIKDKELLKLIRVKYSEYLREKYLINMEKDSDPRYSVLAKIINKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.25
4 0.17
5 0.14
6 0.16
7 0.13
8 0.11
9 0.12
10 0.14
11 0.13
12 0.14
13 0.16
14 0.13
15 0.14
16 0.15
17 0.21
18 0.26
19 0.33
20 0.42
21 0.44
22 0.46
23 0.51
24 0.6
25 0.63
26 0.63
27 0.65
28 0.67
29 0.66
30 0.7
31 0.68
32 0.6
33 0.53
34 0.47
35 0.4
36 0.34
37 0.32
38 0.29
39 0.29
40 0.27
41 0.26
42 0.25
43 0.25
44 0.22
45 0.24
46 0.22
47 0.23
48 0.25
49 0.28
50 0.32
51 0.36
52 0.39
53 0.4
54 0.49
55 0.55
56 0.57
57 0.62
58 0.68
59 0.72
60 0.75
61 0.81
62 0.81
63 0.82
64 0.89
65 0.85
66 0.81
67 0.74
68 0.65
69 0.59
70 0.52
71 0.46
72 0.42
73 0.4
74 0.4
75 0.44
76 0.43
77 0.38
78 0.35
79 0.31
80 0.31
81 0.3
82 0.29
83 0.29
84 0.3
85 0.38
86 0.39
87 0.4
88 0.39
89 0.4
90 0.41
91 0.4
92 0.45
93 0.42
94 0.44
95 0.47
96 0.44
97 0.4
98 0.35
99 0.3
100 0.29
101 0.27
102 0.26
103 0.22
104 0.23
105 0.27
106 0.3
107 0.35
108 0.35
109 0.38
110 0.42
111 0.47
112 0.55
113 0.59
114 0.61
115 0.61
116 0.59
117 0.59
118 0.56
119 0.58
120 0.54
121 0.55
122 0.53
123 0.47
124 0.45
125 0.43
126 0.42
127 0.35
128 0.28
129 0.21
130 0.18
131 0.18
132 0.18
133 0.14
134 0.14
135 0.17
136 0.16
137 0.15
138 0.14
139 0.13
140 0.13
141 0.13
142 0.14
143 0.12
144 0.15
145 0.2
146 0.21
147 0.22
148 0.22
149 0.22
150 0.21
151 0.19
152 0.22
153 0.22
154 0.25
155 0.3
156 0.39
157 0.46
158 0.45
159 0.49
160 0.47
161 0.43
162 0.39
163 0.36
164 0.3
165 0.25
166 0.25
167 0.26
168 0.23
169 0.24
170 0.26
171 0.24
172 0.26
173 0.24
174 0.28
175 0.24
176 0.24
177 0.25
178 0.26
179 0.25
180 0.2
181 0.2
182 0.17
183 0.22
184 0.27
185 0.29
186 0.27
187 0.3
188 0.32
189 0.38
190 0.38
191 0.42
192 0.44
193 0.43
194 0.46
195 0.44
196 0.42
197 0.35
198 0.32
199 0.23
200 0.15
201 0.12
202 0.09
203 0.09
204 0.09
205 0.09
206 0.09
207 0.11
208 0.13
209 0.15
210 0.14
211 0.12
212 0.14
213 0.15
214 0.18
215 0.19
216 0.17
217 0.14
218 0.14
219 0.14
220 0.14
221 0.14
222 0.11
223 0.08
224 0.07
225 0.08
226 0.1
227 0.11
228 0.13
229 0.15
230 0.16
231 0.18
232 0.18
233 0.19
234 0.19
235 0.21
236 0.19
237 0.16
238 0.18
239 0.16
240 0.17
241 0.17
242 0.14
243 0.1
244 0.09
245 0.09
246 0.06
247 0.06
248 0.05
249 0.05
250 0.05
251 0.06
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.07
259 0.07
260 0.06
261 0.06
262 0.06
263 0.06
264 0.08
265 0.07
266 0.07
267 0.09
268 0.1
269 0.18
270 0.21
271 0.23
272 0.22
273 0.27
274 0.37
275 0.46
276 0.56
277 0.5
278 0.51
279 0.53
280 0.56
281 0.51
282 0.42
283 0.39
284 0.33
285 0.31
286 0.31
287 0.28
288 0.24
289 0.24
290 0.23
291 0.15
292 0.1
293 0.1
294 0.07
295 0.08
296 0.07
297 0.06
298 0.07
299 0.07
300 0.07
301 0.06
302 0.06
303 0.05
304 0.05
305 0.06
306 0.06
307 0.06
308 0.07
309 0.08
310 0.09
311 0.11
312 0.12
313 0.11
314 0.17
315 0.19
316 0.24
317 0.31
318 0.3
319 0.31
320 0.33
321 0.35
322 0.3
323 0.35
324 0.35
325 0.27
326 0.28
327 0.3
328 0.27
329 0.25
330 0.24
331 0.19
332 0.15
333 0.18
334 0.19
335 0.15
336 0.19
337 0.2
338 0.22
339 0.24
340 0.26
341 0.23
342 0.23
343 0.23
344 0.24
345 0.26
346 0.25
347 0.21
348 0.21
349 0.2
350 0.18
351 0.18
352 0.15
353 0.13
354 0.13
355 0.14
356 0.13
357 0.13
358 0.13
359 0.14
360 0.16
361 0.16
362 0.17
363 0.21
364 0.24
365 0.24
366 0.28
367 0.28
368 0.29
369 0.29
370 0.31
371 0.33
372 0.33
373 0.36
374 0.37
375 0.37
376 0.35
377 0.42
378 0.47
379 0.46
380 0.49
381 0.5
382 0.56
383 0.59
384 0.61
385 0.61
386 0.56
387 0.6
388 0.63
389 0.64
390 0.59
391 0.61
392 0.59
393 0.59
394 0.55
395 0.49
396 0.46
397 0.48
398 0.52
399 0.51
400 0.52
401 0.47
402 0.5
403 0.47
404 0.45
405 0.47
406 0.44
407 0.41
408 0.41
409 0.41
410 0.43
411 0.46
412 0.44
413 0.37
414 0.32
415 0.29
416 0.3
417 0.29
418 0.25
419 0.28
420 0.32