Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376BAE0

Protein Details
Accession A0A376BAE0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-133QPSTLKRKRRIGFLARCRSKTGQNILKRRKTKGRWYLTYHydrophilic
NLS Segment(s)
PositionSequence
100-127KRKRRIGFLARCRSKTGQNILKRRKTKG
Subcellular Location(s) mito 18.5, mito_nucl 12.333, nucl 5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSFITRNISKSVSLCKKTSQQTTSIFNINTTSRLFSTMLTTSTRSPIDHLQKMGSSVTIPETFTIGTSTSTFSSLLTNIGCLLGRRWKSRGNTFQPSTLKRKRRIGFLARCRSKTGQNILKRRKTKGRWYLTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.51
4 0.56
5 0.63
6 0.55
7 0.52
8 0.52
9 0.56
10 0.54
11 0.51
12 0.43
13 0.35
14 0.35
15 0.29
16 0.26
17 0.21
18 0.2
19 0.15
20 0.17
21 0.17
22 0.15
23 0.18
24 0.17
25 0.17
26 0.17
27 0.18
28 0.16
29 0.19
30 0.2
31 0.16
32 0.17
33 0.24
34 0.29
35 0.31
36 0.31
37 0.29
38 0.28
39 0.29
40 0.26
41 0.19
42 0.11
43 0.08
44 0.1
45 0.1
46 0.09
47 0.08
48 0.09
49 0.08
50 0.08
51 0.09
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.07
64 0.07
65 0.06
66 0.07
67 0.06
68 0.06
69 0.08
70 0.14
71 0.18
72 0.21
73 0.24
74 0.3
75 0.35
76 0.45
77 0.53
78 0.54
79 0.6
80 0.59
81 0.63
82 0.64
83 0.63
84 0.63
85 0.63
86 0.64
87 0.62
88 0.7
89 0.67
90 0.69
91 0.73
92 0.74
93 0.75
94 0.77
95 0.8
96 0.77
97 0.76
98 0.73
99 0.67
100 0.63
101 0.61
102 0.61
103 0.59
104 0.61
105 0.7
106 0.75
107 0.82
108 0.8
109 0.81
110 0.81
111 0.81
112 0.83
113 0.82