Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B4P4

Protein Details
Accession A0A376B4P4    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-35NYNNNNNNNNNKKSNRRHGNSFNNSLQHydrophilic
43-62GSNKIKKKIRDTERLLTKKKBasic
NLS Segment(s)
PositionSequence
98-98K
109-110KK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MSTYRNYSNYNNNNNNNNNKKSNRRHGNSFNNSLQIASVIGAGSNKIKKKIRDTERLLTKKKDTLPDTVKIEMERKLDALKLELANAKIRTKATKNAKKYHMVRFFERKKALKLYKKISSELEKNPENPDLSEKLLQASIDLCYVVNFPKTEKYISLYPSNKTTENSENLTTLKRKTYRDQIAKEYKQGTLAVSLDDILKGKRLDKDIIGTLHVDSASNVQENITENEDNEEDDFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.77
4 0.75
5 0.73
6 0.72
7 0.76
8 0.78
9 0.81
10 0.82
11 0.8
12 0.82
13 0.83
14 0.86
15 0.84
16 0.82
17 0.74
18 0.66
19 0.59
20 0.49
21 0.39
22 0.28
23 0.2
24 0.12
25 0.1
26 0.06
27 0.06
28 0.06
29 0.07
30 0.12
31 0.17
32 0.2
33 0.27
34 0.33
35 0.39
36 0.48
37 0.58
38 0.62
39 0.67
40 0.72
41 0.74
42 0.79
43 0.81
44 0.77
45 0.72
46 0.67
47 0.63
48 0.61
49 0.59
50 0.51
51 0.52
52 0.52
53 0.53
54 0.52
55 0.47
56 0.43
57 0.36
58 0.36
59 0.31
60 0.28
61 0.22
62 0.19
63 0.18
64 0.18
65 0.17
66 0.16
67 0.15
68 0.14
69 0.15
70 0.16
71 0.17
72 0.2
73 0.21
74 0.2
75 0.2
76 0.2
77 0.24
78 0.25
79 0.32
80 0.39
81 0.46
82 0.53
83 0.58
84 0.62
85 0.66
86 0.68
87 0.7
88 0.68
89 0.63
90 0.6
91 0.62
92 0.63
93 0.61
94 0.62
95 0.54
96 0.49
97 0.54
98 0.58
99 0.55
100 0.57
101 0.56
102 0.58
103 0.57
104 0.55
105 0.5
106 0.46
107 0.44
108 0.41
109 0.4
110 0.34
111 0.34
112 0.34
113 0.32
114 0.28
115 0.23
116 0.22
117 0.18
118 0.18
119 0.19
120 0.17
121 0.15
122 0.15
123 0.14
124 0.11
125 0.1
126 0.08
127 0.06
128 0.06
129 0.06
130 0.05
131 0.06
132 0.07
133 0.08
134 0.08
135 0.09
136 0.13
137 0.15
138 0.16
139 0.16
140 0.19
141 0.21
142 0.24
143 0.32
144 0.3
145 0.3
146 0.34
147 0.35
148 0.33
149 0.3
150 0.32
151 0.29
152 0.3
153 0.32
154 0.28
155 0.27
156 0.27
157 0.3
158 0.27
159 0.24
160 0.28
161 0.3
162 0.34
163 0.39
164 0.48
165 0.55
166 0.62
167 0.65
168 0.67
169 0.72
170 0.71
171 0.7
172 0.61
173 0.51
174 0.44
175 0.4
176 0.31
177 0.23
178 0.21
179 0.16
180 0.14
181 0.13
182 0.11
183 0.11
184 0.11
185 0.08
186 0.12
187 0.13
188 0.17
189 0.21
190 0.25
191 0.28
192 0.29
193 0.34
194 0.35
195 0.35
196 0.33
197 0.29
198 0.25
199 0.23
200 0.21
201 0.16
202 0.11
203 0.13
204 0.14
205 0.14
206 0.13
207 0.11
208 0.13
209 0.16
210 0.19
211 0.2
212 0.19
213 0.18
214 0.22
215 0.23
216 0.22
217 0.2