Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B3P9

Protein Details
Accession A0A376B3P9    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-43ATIKVNKKLNKKGKSFRQTKFHydrophilic
NLS Segment(s)
PositionSequence
28-44NKKLNKKGKSFRQTKFK
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MAREVTDIKQFLELTRRADIKTATIKVNKKLNKKGKSFRQTKFKVRGSKNLYTLIVDDAAKAKKLIQALPPTLEVNKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.32
4 0.28
5 0.31
6 0.29
7 0.27
8 0.32
9 0.31
10 0.31
11 0.36
12 0.39
13 0.43
14 0.51
15 0.52
16 0.53
17 0.6
18 0.65
19 0.67
20 0.71
21 0.75
22 0.76
23 0.8
24 0.81
25 0.77
26 0.77
27 0.75
28 0.76
29 0.76
30 0.72
31 0.72
32 0.67
33 0.7
34 0.67
35 0.67
36 0.61
37 0.56
38 0.49
39 0.4
40 0.37
41 0.29
42 0.23
43 0.17
44 0.14
45 0.14
46 0.15
47 0.15
48 0.14
49 0.14
50 0.15
51 0.18
52 0.21
53 0.24
54 0.31
55 0.34
56 0.37
57 0.38
58 0.37