Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B7F2

Protein Details
Accession A0A376B7F2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-28VPPGGQRTLQKRRQAQNAKENKLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR030671  Sec61-beta/Sbh  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0005784  C:Sec61 translocon complex  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MSTAVPPGGQRTLQKRRQAQNAKENKLKQTPTSARAAGFGGSSNNILKIFTDEASNGLRVDPLAVLFLAVGFIFSVVALHVIAKMTGKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.68
4 0.76
5 0.8
6 0.79
7 0.8
8 0.82
9 0.8
10 0.79
11 0.75
12 0.7
13 0.67
14 0.6
15 0.51
16 0.51
17 0.49
18 0.45
19 0.46
20 0.41
21 0.34
22 0.32
23 0.31
24 0.21
25 0.16
26 0.13
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.09
37 0.08
38 0.09
39 0.08
40 0.1
41 0.11
42 0.12
43 0.1
44 0.08
45 0.08
46 0.07
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.06
69 0.07
70 0.08