Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B2Y6

Protein Details
Accession A0A376B2Y6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-90NYSSNNNNNNQKRNKGKKSKSVKTRENNNYQNKCIHydrophilic
NLS Segment(s)
PositionSequence
67-76KRNKGKKSKS
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MLVSLLHLDSQDTIYEHIFERYIELENNSNYLKQDLGIQNRSLELIEIDIDPPPENYSSNNNNNNQKRNKGKKSKSVKTRENNNYQNKCINDSYHLSINQSLCSLNSTQNNNSTTGFVLWQSSPLFIKWLLYQESASSFRNGHTSSDSKDTILPLCDESTILLELGCGISGILPIILSNYVCTYIATDQNSILNKLKKNILSNINEINKREVISKTLGITKSQDEEFENYKQSKNDNHNTKKEVVLEICPLDWEHPMSPATDLFLNTLITSPLKQNNNLLILAMDVIYNTYLIEPFLSTIDTIFQKYSKKNFFPGKVQCFVGIQLRTQDVVEEFLIKAVEKHQFMVKFIDDPMFLNKSRFAYYLIEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.16
5 0.15
6 0.14
7 0.15
8 0.15
9 0.17
10 0.17
11 0.19
12 0.22
13 0.22
14 0.25
15 0.24
16 0.24
17 0.22
18 0.21
19 0.19
20 0.14
21 0.22
22 0.26
23 0.33
24 0.36
25 0.37
26 0.37
27 0.37
28 0.37
29 0.28
30 0.22
31 0.14
32 0.1
33 0.1
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.13
41 0.13
42 0.12
43 0.14
44 0.21
45 0.29
46 0.37
47 0.45
48 0.49
49 0.58
50 0.65
51 0.73
52 0.71
53 0.72
54 0.74
55 0.77
56 0.81
57 0.82
58 0.84
59 0.85
60 0.89
61 0.9
62 0.89
63 0.89
64 0.88
65 0.87
66 0.89
67 0.88
68 0.87
69 0.87
70 0.87
71 0.82
72 0.76
73 0.72
74 0.63
75 0.58
76 0.5
77 0.42
78 0.36
79 0.34
80 0.34
81 0.33
82 0.32
83 0.29
84 0.3
85 0.29
86 0.25
87 0.21
88 0.18
89 0.13
90 0.15
91 0.15
92 0.15
93 0.2
94 0.24
95 0.26
96 0.32
97 0.33
98 0.32
99 0.31
100 0.27
101 0.23
102 0.19
103 0.17
104 0.12
105 0.12
106 0.11
107 0.12
108 0.12
109 0.12
110 0.12
111 0.12
112 0.13
113 0.11
114 0.12
115 0.11
116 0.14
117 0.16
118 0.16
119 0.16
120 0.15
121 0.18
122 0.2
123 0.19
124 0.17
125 0.15
126 0.15
127 0.19
128 0.19
129 0.17
130 0.18
131 0.19
132 0.2
133 0.25
134 0.25
135 0.21
136 0.21
137 0.21
138 0.18
139 0.17
140 0.15
141 0.11
142 0.11
143 0.11
144 0.1
145 0.09
146 0.08
147 0.07
148 0.06
149 0.05
150 0.05
151 0.05
152 0.04
153 0.04
154 0.03
155 0.02
156 0.02
157 0.03
158 0.03
159 0.02
160 0.02
161 0.02
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.06
171 0.08
172 0.11
173 0.12
174 0.12
175 0.12
176 0.15
177 0.15
178 0.16
179 0.19
180 0.21
181 0.2
182 0.22
183 0.27
184 0.26
185 0.29
186 0.33
187 0.36
188 0.35
189 0.37
190 0.41
191 0.42
192 0.41
193 0.39
194 0.36
195 0.29
196 0.27
197 0.26
198 0.2
199 0.18
200 0.18
201 0.19
202 0.17
203 0.22
204 0.22
205 0.2
206 0.21
207 0.2
208 0.2
209 0.19
210 0.19
211 0.15
212 0.18
213 0.2
214 0.2
215 0.23
216 0.22
217 0.24
218 0.24
219 0.26
220 0.3
221 0.35
222 0.42
223 0.49
224 0.56
225 0.6
226 0.63
227 0.62
228 0.57
229 0.51
230 0.45
231 0.36
232 0.3
233 0.26
234 0.22
235 0.2
236 0.17
237 0.15
238 0.13
239 0.12
240 0.12
241 0.1
242 0.12
243 0.12
244 0.12
245 0.13
246 0.12
247 0.12
248 0.11
249 0.11
250 0.1
251 0.11
252 0.11
253 0.1
254 0.1
255 0.1
256 0.09
257 0.1
258 0.13
259 0.19
260 0.22
261 0.23
262 0.26
263 0.3
264 0.32
265 0.31
266 0.27
267 0.19
268 0.17
269 0.16
270 0.12
271 0.07
272 0.04
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.05
280 0.06
281 0.06
282 0.06
283 0.07
284 0.07
285 0.07
286 0.07
287 0.11
288 0.11
289 0.13
290 0.13
291 0.16
292 0.21
293 0.28
294 0.37
295 0.42
296 0.44
297 0.52
298 0.6
299 0.63
300 0.67
301 0.71
302 0.69
303 0.63
304 0.61
305 0.53
306 0.45
307 0.42
308 0.4
309 0.31
310 0.25
311 0.25
312 0.25
313 0.25
314 0.24
315 0.23
316 0.16
317 0.18
318 0.17
319 0.15
320 0.13
321 0.14
322 0.14
323 0.12
324 0.13
325 0.15
326 0.21
327 0.2
328 0.22
329 0.27
330 0.29
331 0.31
332 0.35
333 0.32
334 0.27
335 0.28
336 0.29
337 0.23
338 0.23
339 0.27
340 0.26
341 0.26
342 0.26
343 0.28
344 0.28
345 0.31
346 0.3
347 0.28