Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F2XXS6

Protein Details
Accession A0A3F2XXS6   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-48IDPTLWAKRKQLSRQKKELDKIAYGKKRRDERANKPDLRTHydrophilic
NLS Segment(s)
PositionSequence
16-41KRKQLSRQKKELDKIAYGKKRRDERA
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MGSQAFADIDPTLWAKRKQLSRQKKELDKIAYGKKRRDERANKPDLRTSGVIWKQEGITNEALLKEIRALKKKNREYELKNAKLRSECDIKREEMSCLRKKIGDVSRDNRSWALRQSKLVXENKQLKXEVSALRRKLGKHLAERVSMQAQYSAXVSELGNNENDEENEENGYYDENEGETDPSIGIRMQKEDDTDSIYNDRXATTRSKGRFDSEDEDMDTEKLLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.34
4 0.43
5 0.52
6 0.61
7 0.69
8 0.73
9 0.81
10 0.86
11 0.87
12 0.85
13 0.83
14 0.78
15 0.73
16 0.71
17 0.71
18 0.7
19 0.68
20 0.68
21 0.68
22 0.71
23 0.72
24 0.75
25 0.75
26 0.77
27 0.81
28 0.85
29 0.82
30 0.77
31 0.75
32 0.66
33 0.61
34 0.51
35 0.42
36 0.41
37 0.4
38 0.38
39 0.32
40 0.32
41 0.27
42 0.29
43 0.28
44 0.22
45 0.18
46 0.17
47 0.17
48 0.16
49 0.16
50 0.13
51 0.11
52 0.11
53 0.16
54 0.21
55 0.27
56 0.32
57 0.4
58 0.5
59 0.58
60 0.63
61 0.64
62 0.67
63 0.65
64 0.71
65 0.73
66 0.71
67 0.68
68 0.61
69 0.58
70 0.53
71 0.49
72 0.43
73 0.41
74 0.34
75 0.34
76 0.35
77 0.34
78 0.33
79 0.33
80 0.3
81 0.29
82 0.36
83 0.37
84 0.37
85 0.36
86 0.34
87 0.33
88 0.39
89 0.38
90 0.37
91 0.38
92 0.39
93 0.45
94 0.45
95 0.45
96 0.38
97 0.34
98 0.28
99 0.28
100 0.3
101 0.25
102 0.27
103 0.3
104 0.35
105 0.41
106 0.41
107 0.44
108 0.42
109 0.41
110 0.44
111 0.41
112 0.35
113 0.31
114 0.33
115 0.34
116 0.38
117 0.38
118 0.34
119 0.39
120 0.39
121 0.42
122 0.45
123 0.42
124 0.4
125 0.47
126 0.48
127 0.45
128 0.46
129 0.42
130 0.36
131 0.31
132 0.25
133 0.17
134 0.14
135 0.12
136 0.12
137 0.1
138 0.08
139 0.07
140 0.07
141 0.09
142 0.11
143 0.11
144 0.11
145 0.11
146 0.12
147 0.12
148 0.15
149 0.14
150 0.12
151 0.12
152 0.12
153 0.11
154 0.1
155 0.11
156 0.09
157 0.08
158 0.07
159 0.07
160 0.07
161 0.08
162 0.09
163 0.08
164 0.08
165 0.08
166 0.07
167 0.08
168 0.08
169 0.12
170 0.12
171 0.15
172 0.17
173 0.18
174 0.21
175 0.23
176 0.23
177 0.26
178 0.24
179 0.24
180 0.24
181 0.24
182 0.22
183 0.2
184 0.2
185 0.16
186 0.2
187 0.23
188 0.3
189 0.38
190 0.42
191 0.46
192 0.5
193 0.52
194 0.54
195 0.53
196 0.49
197 0.43
198 0.41
199 0.38
200 0.34
201 0.29
202 0.24