Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F2XX34

Protein Details
Accession A0A3F2XX34    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
335-363LEKLNAKDRRLRRLKKRDSERLERKIKSDBasic
NLS Segment(s)
PositionSequence
346-364KDRRLRRLKKRDSERLERK
400-411KPKERKKIRSSK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDKFRPISRKYDLIIAERELLRDKANFPHEIDRNLDEYVERLNPGGYLVILERGNPLGAEVIARARQLMLRPENFKNHLAKIARPYKRFSETXKEVIAESGKSSRAYHKLLKEVGPEYVEALEEKREIEPGEVPEEVPENSINLEVVAPCPHFGMCPLQYSKPEVFGFGGIGKKLKFCSFMTHVQRPRYLLELKRGAKLATKWTSPTSGIAIKGKXTPGGGRPFGRDTEKASFAYLIVKRSEKSDRELLESRNAETGVRNIGYKAQSXSECPRILXPPKKKKHLVIMDMCAPSGHIEKWHVPRSVGKDXYHDATKAKMGDIWSLGAKSIIQSRKENVFYLEKLNAKDRRLRRLKKRDSERLERKIKSDYRQALDIEPAANDLGVAVSKMASMDXYSLISKPKERKKIRSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.43
4 0.37
5 0.37
6 0.33
7 0.3
8 0.28
9 0.27
10 0.27
11 0.3
12 0.34
13 0.35
14 0.36
15 0.44
16 0.45
17 0.45
18 0.47
19 0.41
20 0.38
21 0.36
22 0.32
23 0.23
24 0.2
25 0.21
26 0.18
27 0.16
28 0.14
29 0.14
30 0.13
31 0.14
32 0.13
33 0.09
34 0.08
35 0.08
36 0.12
37 0.12
38 0.12
39 0.13
40 0.13
41 0.13
42 0.12
43 0.12
44 0.08
45 0.08
46 0.09
47 0.08
48 0.11
49 0.12
50 0.12
51 0.12
52 0.12
53 0.14
54 0.18
55 0.25
56 0.3
57 0.34
58 0.4
59 0.45
60 0.51
61 0.53
62 0.55
63 0.51
64 0.45
65 0.47
66 0.44
67 0.43
68 0.46
69 0.52
70 0.55
71 0.53
72 0.55
73 0.54
74 0.6
75 0.59
76 0.56
77 0.56
78 0.51
79 0.53
80 0.52
81 0.46
82 0.38
83 0.37
84 0.31
85 0.22
86 0.22
87 0.19
88 0.17
89 0.18
90 0.23
91 0.27
92 0.32
93 0.37
94 0.39
95 0.44
96 0.46
97 0.47
98 0.45
99 0.41
100 0.37
101 0.31
102 0.26
103 0.2
104 0.17
105 0.14
106 0.1
107 0.1
108 0.09
109 0.09
110 0.1
111 0.09
112 0.1
113 0.1
114 0.11
115 0.13
116 0.14
117 0.16
118 0.15
119 0.15
120 0.14
121 0.15
122 0.14
123 0.12
124 0.1
125 0.08
126 0.08
127 0.08
128 0.07
129 0.06
130 0.06
131 0.05
132 0.06
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.09
140 0.13
141 0.13
142 0.17
143 0.2
144 0.21
145 0.23
146 0.27
147 0.26
148 0.26
149 0.24
150 0.21
151 0.19
152 0.17
153 0.16
154 0.14
155 0.15
156 0.1
157 0.12
158 0.11
159 0.12
160 0.13
161 0.14
162 0.15
163 0.14
164 0.2
165 0.23
166 0.32
167 0.38
168 0.45
169 0.49
170 0.49
171 0.5
172 0.45
173 0.41
174 0.37
175 0.34
176 0.29
177 0.31
178 0.36
179 0.36
180 0.37
181 0.36
182 0.32
183 0.31
184 0.3
185 0.31
186 0.26
187 0.25
188 0.25
189 0.25
190 0.27
191 0.24
192 0.23
193 0.17
194 0.15
195 0.16
196 0.17
197 0.16
198 0.15
199 0.17
200 0.16
201 0.15
202 0.14
203 0.16
204 0.17
205 0.22
206 0.22
207 0.24
208 0.26
209 0.26
210 0.29
211 0.26
212 0.27
213 0.27
214 0.29
215 0.24
216 0.23
217 0.21
218 0.18
219 0.24
220 0.2
221 0.18
222 0.18
223 0.19
224 0.19
225 0.22
226 0.29
227 0.24
228 0.27
229 0.31
230 0.3
231 0.35
232 0.39
233 0.37
234 0.38
235 0.37
236 0.34
237 0.29
238 0.28
239 0.22
240 0.19
241 0.18
242 0.14
243 0.13
244 0.13
245 0.11
246 0.15
247 0.16
248 0.17
249 0.18
250 0.16
251 0.21
252 0.26
253 0.32
254 0.28
255 0.29
256 0.29
257 0.37
258 0.44
259 0.5
260 0.55
261 0.6
262 0.68
263 0.74
264 0.77
265 0.77
266 0.77
267 0.75
268 0.71
269 0.64
270 0.62
271 0.54
272 0.5
273 0.4
274 0.31
275 0.23
276 0.19
277 0.15
278 0.11
279 0.14
280 0.21
281 0.28
282 0.35
283 0.35
284 0.34
285 0.4
286 0.45
287 0.51
288 0.47
289 0.43
290 0.42
291 0.43
292 0.48
293 0.47
294 0.41
295 0.33
296 0.37
297 0.34
298 0.28
299 0.29
300 0.24
301 0.21
302 0.21
303 0.21
304 0.16
305 0.15
306 0.15
307 0.13
308 0.12
309 0.11
310 0.18
311 0.22
312 0.25
313 0.28
314 0.32
315 0.39
316 0.42
317 0.41
318 0.38
319 0.38
320 0.35
321 0.37
322 0.38
323 0.35
324 0.35
325 0.42
326 0.43
327 0.41
328 0.49
329 0.51
330 0.56
331 0.63
332 0.71
333 0.74
334 0.8
335 0.87
336 0.88
337 0.93
338 0.92
339 0.91
340 0.92
341 0.91
342 0.9
343 0.89
344 0.81
345 0.74
346 0.73
347 0.71
348 0.67
349 0.67
350 0.65
351 0.6
352 0.61
353 0.59
354 0.51
355 0.48
356 0.42
357 0.33
358 0.24
359 0.21
360 0.16
361 0.14
362 0.11
363 0.08
364 0.07
365 0.06
366 0.06
367 0.05
368 0.05
369 0.05
370 0.06
371 0.06
372 0.06
373 0.06
374 0.08
375 0.09
376 0.12
377 0.13
378 0.17
379 0.2
380 0.27
381 0.36
382 0.44
383 0.54
384 0.61
385 0.7