Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F2XXM3

Protein Details
Accession A0A3F2XXM3    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MAQGKLKLAKKKPHRVTKRQRNPKAKARKIFKPKKISFREREBasic
NLS Segment(s)
PositionSequence
5-57KLKLAKKKPHRVTKRQRNPKAKARKIFKPKKISFRERELHKLDKKERGRLWEA
60-60K
73-90KGTRREIEANEKKAKQKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGKLKLAKKKPHRVTKRQRNPKAKARKIFKPKKISFRERELHKLDKKERGRLWEATEKAISAKIGHLELLKGTRREIEANEKKAKQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.92
4 0.94
5 0.94
6 0.94
7 0.95
8 0.94
9 0.92
10 0.91
11 0.91
12 0.89
13 0.87
14 0.83
15 0.82
16 0.83
17 0.85
18 0.84
19 0.83
20 0.81
21 0.82
22 0.84
23 0.83
24 0.78
25 0.76
26 0.74
27 0.67
28 0.68
29 0.62
30 0.61
31 0.56
32 0.58
33 0.54
34 0.56
35 0.55
36 0.56
37 0.54
38 0.52
39 0.52
40 0.47
41 0.49
42 0.47
43 0.44
44 0.39
45 0.36
46 0.3
47 0.26
48 0.24
49 0.18
50 0.11
51 0.12
52 0.11
53 0.11
54 0.12
55 0.11
56 0.11
57 0.12
58 0.17
59 0.21
60 0.2
61 0.2
62 0.22
63 0.24
64 0.26
65 0.29
66 0.35
67 0.4
68 0.47
69 0.55
70 0.57