Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F2XXE8

Protein Details
Accession A0A3F2XXE8   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-28GAHFGRHRKYLWKRNERNERMNNDRQVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, nucl 6, mito 5.5, cyto_mito 3.5, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MGAHFGRHRKYLWKRNERNERMNNDRQVLIELASVQKFEFFRENLINWYKFNFKSAGIALFFLGVVPVTLGWIGYKYQTINMIAARRDKPVYDNEWVPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.91
4 0.89
5 0.88
6 0.87
7 0.85
8 0.82
9 0.81
10 0.75
11 0.66
12 0.59
13 0.49
14 0.42
15 0.34
16 0.25
17 0.17
18 0.13
19 0.12
20 0.11
21 0.11
22 0.09
23 0.11
24 0.1
25 0.12
26 0.14
27 0.12
28 0.15
29 0.17
30 0.18
31 0.2
32 0.24
33 0.23
34 0.2
35 0.22
36 0.22
37 0.2
38 0.21
39 0.18
40 0.14
41 0.15
42 0.16
43 0.16
44 0.13
45 0.13
46 0.11
47 0.1
48 0.1
49 0.07
50 0.06
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.05
61 0.06
62 0.08
63 0.08
64 0.1
65 0.13
66 0.14
67 0.15
68 0.18
69 0.22
70 0.23
71 0.29
72 0.29
73 0.3
74 0.31
75 0.3
76 0.3
77 0.33
78 0.36
79 0.35
80 0.4