Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F2XWX5

Protein Details
Accession A0A3F2XWX5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
37-56KGPVYVRHKNYTKKRAKLVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MIRLIKKQITIYEKETARLPIIRQNILEGLILQVNEKGPVYVRHKNYTKKRAKLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.33
4 0.3
5 0.27
6 0.24
7 0.23
8 0.26
9 0.26
10 0.24
11 0.23
12 0.21
13 0.2
14 0.18
15 0.12
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.07
23 0.07
24 0.07
25 0.08
26 0.15
27 0.22
28 0.29
29 0.34
30 0.43
31 0.5
32 0.6
33 0.69
34 0.73
35 0.76
36 0.77