Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DQN7

Protein Details
Accession A0A371DQN7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-32LDLPKATPGRRRRRRVIVQLVQKESHydrophilic
NLS Segment(s)
PositionSequence
15-22PGRRRRRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MYSYQPFLDLPKATPGRRRRRRVIVQLVQKESAGRDVIAHQRRRMQARRRVLHTCKENTPPLRLLARTRLSEVPGMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.56
4 0.65
5 0.72
6 0.72
7 0.77
8 0.85
9 0.86
10 0.87
11 0.84
12 0.84
13 0.82
14 0.76
15 0.66
16 0.56
17 0.46
18 0.35
19 0.28
20 0.19
21 0.11
22 0.09
23 0.11
24 0.2
25 0.26
26 0.28
27 0.28
28 0.34
29 0.38
30 0.45
31 0.51
32 0.52
33 0.55
34 0.63
35 0.67
36 0.67
37 0.72
38 0.7
39 0.7
40 0.68
41 0.64
42 0.59
43 0.58
44 0.6
45 0.55
46 0.55
47 0.48
48 0.44
49 0.43
50 0.41
51 0.39
52 0.41
53 0.43
54 0.41
55 0.43
56 0.42
57 0.4