Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DQJ7

Protein Details
Accession A0A371DQJ7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRRNNGRNKNGRGHVNFHydrophilic
NLS Segment(s)
PositionSequence
87-109RSREGRRNRAPPPRVRWKDGKKV
Subcellular Location(s) nucl 11.5, mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNNGRNKNGRGHVNFVRCSNCSRCVPKDKAIKRFTVRNMVETAAVRDLSEASVYQEYVIPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRVRWKDGKKVNPAVAAAEDAKAAAARGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.77
3 0.73
4 0.69
5 0.66
6 0.6
7 0.54
8 0.51
9 0.43
10 0.44
11 0.41
12 0.4
13 0.39
14 0.43
15 0.47
16 0.52
17 0.56
18 0.59
19 0.65
20 0.67
21 0.7
22 0.67
23 0.68
24 0.63
25 0.65
26 0.61
27 0.61
28 0.54
29 0.47
30 0.44
31 0.37
32 0.35
33 0.27
34 0.25
35 0.15
36 0.14
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.09
54 0.1
55 0.09
56 0.1
57 0.12
58 0.13
59 0.13
60 0.14
61 0.14
62 0.13
63 0.12
64 0.13
65 0.13
66 0.18
67 0.17
68 0.2
69 0.23
70 0.27
71 0.28
72 0.3
73 0.33
74 0.36
75 0.42
76 0.48
77 0.54
78 0.59
79 0.66
80 0.72
81 0.74
82 0.76
83 0.79
84 0.79
85 0.79
86 0.8
87 0.77
88 0.76
89 0.78
90 0.76
91 0.79
92 0.79
93 0.79
94 0.77
95 0.79
96 0.77
97 0.7
98 0.61
99 0.53
100 0.44
101 0.37
102 0.29
103 0.21
104 0.16
105 0.12
106 0.12
107 0.1