Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371D5L8

Protein Details
Accession A0A371D5L8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-63LGPECPPPRISRRPRIRRSMPSMRPPPLHydrophilic
NLS Segment(s)
PositionSequence
47-52RRPRIR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSHPPDPPSPLTLAVALGPPPRPPRPQPLWLDHHLLGPECPPPRISRRPRIRRSMPSMRPPPLISLPLPPSPALLAPSTPYALSPSLLPEQPALDHSPAGSSNETRPRCSSVRSATYPPLHPRLATSILELEDALRTDFSLGTSISLGTGITPGSIDLDTFLGPEVVFEIENDAGFQPPPPLLTHRSASIAISHASAARLRARAERAPDAPKKVFSAPGICKLPGGPPKRSSLIPTPPLYPAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.16
5 0.16
6 0.2
7 0.26
8 0.31
9 0.36
10 0.4
11 0.48
12 0.53
13 0.61
14 0.63
15 0.65
16 0.67
17 0.64
18 0.65
19 0.56
20 0.52
21 0.44
22 0.37
23 0.29
24 0.24
25 0.25
26 0.21
27 0.21
28 0.19
29 0.23
30 0.31
31 0.41
32 0.49
33 0.54
34 0.63
35 0.73
36 0.81
37 0.86
38 0.87
39 0.86
40 0.86
41 0.86
42 0.83
43 0.83
44 0.82
45 0.75
46 0.69
47 0.61
48 0.56
49 0.48
50 0.43
51 0.33
52 0.31
53 0.31
54 0.3
55 0.3
56 0.25
57 0.22
58 0.2
59 0.2
60 0.15
61 0.12
62 0.1
63 0.1
64 0.11
65 0.11
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.09
72 0.11
73 0.13
74 0.13
75 0.14
76 0.12
77 0.12
78 0.12
79 0.13
80 0.12
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.12
87 0.11
88 0.1
89 0.14
90 0.23
91 0.25
92 0.25
93 0.27
94 0.3
95 0.3
96 0.32
97 0.32
98 0.3
99 0.35
100 0.36
101 0.37
102 0.38
103 0.39
104 0.4
105 0.38
106 0.36
107 0.3
108 0.27
109 0.25
110 0.23
111 0.24
112 0.21
113 0.18
114 0.14
115 0.14
116 0.14
117 0.13
118 0.1
119 0.07
120 0.07
121 0.06
122 0.05
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.07
157 0.07
158 0.07
159 0.08
160 0.07
161 0.07
162 0.08
163 0.08
164 0.07
165 0.07
166 0.09
167 0.1
168 0.13
169 0.17
170 0.21
171 0.22
172 0.23
173 0.25
174 0.25
175 0.23
176 0.21
177 0.19
178 0.15
179 0.14
180 0.13
181 0.11
182 0.12
183 0.12
184 0.13
185 0.16
186 0.18
187 0.19
188 0.24
189 0.29
190 0.32
191 0.37
192 0.41
193 0.41
194 0.48
195 0.52
196 0.54
197 0.52
198 0.5
199 0.48
200 0.44
201 0.43
202 0.38
203 0.41
204 0.38
205 0.44
206 0.45
207 0.41
208 0.39
209 0.36
210 0.41
211 0.4
212 0.41
213 0.4
214 0.4
215 0.46
216 0.49
217 0.5
218 0.48
219 0.49
220 0.54
221 0.54
222 0.53
223 0.49