Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CKK6

Protein Details
Accession A0A371CKK6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-105VQPRRRPSKRRARRALHALPBasic
NLS Segment(s)
PositionSequence
88-104PRRRPSKRRARRALHAL
111-113RPK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MSVTTPIQSRTLRSILRNGATPRTTLRIAIPSPAATTATTVPANALDDSNHLANEDPNHIDLDTPLPSPPLPPPPPPNTPTVRFAVQPRRRPSKRRARRALHALPYNGALRPKRRQIPDDAHNALSIVDQAERDQLRRKQHSSSCDLEKAALAALELWGPLVLDRGVWDENSVEPDDSTSRGRRRRQPEVVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.46
4 0.49
5 0.47
6 0.48
7 0.44
8 0.43
9 0.38
10 0.36
11 0.34
12 0.29
13 0.29
14 0.28
15 0.27
16 0.29
17 0.27
18 0.23
19 0.23
20 0.23
21 0.2
22 0.14
23 0.15
24 0.13
25 0.15
26 0.14
27 0.13
28 0.12
29 0.12
30 0.13
31 0.12
32 0.11
33 0.08
34 0.1
35 0.13
36 0.13
37 0.12
38 0.1
39 0.1
40 0.11
41 0.13
42 0.14
43 0.12
44 0.12
45 0.13
46 0.13
47 0.13
48 0.12
49 0.12
50 0.11
51 0.1
52 0.1
53 0.1
54 0.1
55 0.11
56 0.14
57 0.2
58 0.22
59 0.26
60 0.32
61 0.37
62 0.42
63 0.43
64 0.45
65 0.41
66 0.41
67 0.4
68 0.37
69 0.32
70 0.29
71 0.33
72 0.39
73 0.42
74 0.47
75 0.51
76 0.58
77 0.62
78 0.66
79 0.7
80 0.71
81 0.74
82 0.76
83 0.79
84 0.75
85 0.78
86 0.81
87 0.78
88 0.74
89 0.68
90 0.57
91 0.47
92 0.43
93 0.36
94 0.28
95 0.24
96 0.2
97 0.22
98 0.27
99 0.34
100 0.39
101 0.42
102 0.44
103 0.48
104 0.54
105 0.54
106 0.56
107 0.51
108 0.45
109 0.41
110 0.38
111 0.3
112 0.21
113 0.16
114 0.08
115 0.06
116 0.06
117 0.06
118 0.11
119 0.12
120 0.14
121 0.21
122 0.26
123 0.35
124 0.42
125 0.45
126 0.48
127 0.53
128 0.58
129 0.56
130 0.57
131 0.53
132 0.49
133 0.46
134 0.38
135 0.33
136 0.26
137 0.21
138 0.15
139 0.09
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.06
149 0.05
150 0.05
151 0.06
152 0.1
153 0.11
154 0.11
155 0.12
156 0.11
157 0.12
158 0.16
159 0.17
160 0.14
161 0.13
162 0.15
163 0.16
164 0.18
165 0.22
166 0.26
167 0.34
168 0.42
169 0.51
170 0.59
171 0.67
172 0.75