Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2R4N7

Protein Details
Accession A2R4N7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-26GKGVMSRSCRRNFRKNCGGIRRHIHydrophilic
84-108ENSQEIQEKKKEKKGRRLKEKEKEFBasic
NLS Segment(s)
PositionSequence
92-107KKKEKKGRRLKEKEKE
Subcellular Location(s) nucl 15, mito_nucl 14.5, mito 12
Family & Domain DBs
Amino Acid Sequences MNGKGVMSRSCRRNFRKNCGGIRRHITATMNKARDVITTSVRAMQFSLRINVWAAMGMSRQEEPASHVESLKGGKLFKMGRSTENSQEIQEKKKEKKGRRLKEKEKEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.81
4 0.81
5 0.83
6 0.83
7 0.8
8 0.77
9 0.74
10 0.68
11 0.59
12 0.53
13 0.47
14 0.42
15 0.46
16 0.46
17 0.42
18 0.37
19 0.37
20 0.34
21 0.31
22 0.29
23 0.23
24 0.18
25 0.18
26 0.18
27 0.22
28 0.21
29 0.2
30 0.17
31 0.16
32 0.16
33 0.15
34 0.16
35 0.12
36 0.12
37 0.13
38 0.12
39 0.11
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.09
51 0.12
52 0.14
53 0.14
54 0.14
55 0.14
56 0.15
57 0.16
58 0.15
59 0.14
60 0.11
61 0.11
62 0.17
63 0.18
64 0.21
65 0.27
66 0.27
67 0.29
68 0.36
69 0.4
70 0.41
71 0.44
72 0.41
73 0.36
74 0.42
75 0.41
76 0.41
77 0.44
78 0.46
79 0.48
80 0.57
81 0.65
82 0.68
83 0.76
84 0.8
85 0.84
86 0.87
87 0.91
88 0.93