Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CQ21

Protein Details
Accession A0A371CQ21   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-44DGACHGRRRGRARARSRSWLPBasic
NLS Segment(s)
PositionSequence
30-40RRRGRARARSR
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MSRPGRPPPALPLEQLNHVVDYLDGACHGRRRGRARARSRSWLPAIAMRRVMTRPVTGGPVRVALSPGVPLARLSVFLSLVVPRSSCAWRGSLSVARSQSRGYLGLRRFSHALLLLTRSATVAHSPRKGAYSCACSRVYSRCTSTPHLLKYTPFSIHACCSRLHVYARHEQAPAALVMQPKTRTSTTLPPSSSITPSVAPVRLTRHPSYAVRSCPVYYSSHPSHDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.36
4 0.28
5 0.26
6 0.24
7 0.16
8 0.15
9 0.12
10 0.09
11 0.08
12 0.09
13 0.11
14 0.16
15 0.21
16 0.24
17 0.32
18 0.39
19 0.49
20 0.58
21 0.66
22 0.72
23 0.79
24 0.8
25 0.82
26 0.8
27 0.77
28 0.7
29 0.63
30 0.55
31 0.51
32 0.48
33 0.42
34 0.4
35 0.32
36 0.32
37 0.29
38 0.31
39 0.26
40 0.23
41 0.21
42 0.2
43 0.25
44 0.22
45 0.23
46 0.2
47 0.2
48 0.2
49 0.18
50 0.17
51 0.12
52 0.12
53 0.11
54 0.1
55 0.08
56 0.07
57 0.07
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.08
64 0.08
65 0.09
66 0.08
67 0.1
68 0.09
69 0.08
70 0.08
71 0.11
72 0.12
73 0.13
74 0.14
75 0.14
76 0.14
77 0.16
78 0.19
79 0.2
80 0.2
81 0.22
82 0.24
83 0.23
84 0.23
85 0.22
86 0.2
87 0.17
88 0.18
89 0.15
90 0.19
91 0.2
92 0.27
93 0.27
94 0.27
95 0.27
96 0.25
97 0.25
98 0.19
99 0.18
100 0.11
101 0.12
102 0.11
103 0.1
104 0.1
105 0.09
106 0.08
107 0.07
108 0.09
109 0.12
110 0.16
111 0.17
112 0.18
113 0.19
114 0.21
115 0.22
116 0.22
117 0.21
118 0.24
119 0.25
120 0.29
121 0.29
122 0.27
123 0.28
124 0.32
125 0.31
126 0.28
127 0.3
128 0.3
129 0.33
130 0.37
131 0.42
132 0.42
133 0.42
134 0.42
135 0.39
136 0.36
137 0.36
138 0.35
139 0.29
140 0.25
141 0.23
142 0.22
143 0.24
144 0.27
145 0.24
146 0.21
147 0.24
148 0.24
149 0.26
150 0.27
151 0.29
152 0.3
153 0.37
154 0.41
155 0.4
156 0.37
157 0.34
158 0.32
159 0.28
160 0.23
161 0.16
162 0.13
163 0.12
164 0.14
165 0.18
166 0.19
167 0.19
168 0.23
169 0.23
170 0.24
171 0.27
172 0.35
173 0.37
174 0.43
175 0.43
176 0.41
177 0.44
178 0.44
179 0.41
180 0.33
181 0.28
182 0.21
183 0.23
184 0.25
185 0.23
186 0.22
187 0.23
188 0.27
189 0.31
190 0.38
191 0.37
192 0.38
193 0.41
194 0.44
195 0.49
196 0.5
197 0.49
198 0.46
199 0.46
200 0.42
201 0.39
202 0.38
203 0.35
204 0.32
205 0.36
206 0.37