Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DF93

Protein Details
Accession A0A371DF93    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
308-352DYHGQHGRRRKHTDEARPRRTRVRARGSRRVQRRTPRSPQQSGIEBasic
NLS Segment(s)
PositionSequence
313-344HGRRRKHTDEARPRRTRVRARGSRRVQRRTPR
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSRSPYRTPASHSPRSPEDTRASLNEHRYVLYCTSPFIRAHASQPTVRTRPHQPTPVSRRSDEVENRANGAISRRVCTRPLVSRPASVRVQQSRPKHAHHDIPDLRKCRASRGDIVRHPPTQVPPSAARAQTDSVQTHPTLRTPTYAFALVGDVLKDRPIRRVPAARPTFTGSTVPVPRRTAAPTLAGSPVGRSDLARRAFAPSGTVSQSLVSWRRPAKSAKSTVRRCSPQATGRRLSRIASLTRRRLGDDVLPSTRPASESNDAFGACACGRVRVRVRPATRHLPACPAVQHTGLCAQSSGRRLERDYHGQHGRRRKHTDEARPRRTRVRARGSRRVQRRTPRSPQQSGIEDAVVQGRKREARRVQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.62
4 0.58
5 0.55
6 0.51
7 0.5
8 0.47
9 0.47
10 0.46
11 0.49
12 0.48
13 0.43
14 0.39
15 0.37
16 0.37
17 0.33
18 0.32
19 0.26
20 0.24
21 0.25
22 0.28
23 0.26
24 0.25
25 0.29
26 0.26
27 0.3
28 0.35
29 0.37
30 0.36
31 0.41
32 0.47
33 0.46
34 0.46
35 0.47
36 0.48
37 0.53
38 0.58
39 0.61
40 0.58
41 0.65
42 0.72
43 0.76
44 0.73
45 0.65
46 0.6
47 0.56
48 0.59
49 0.54
50 0.53
51 0.51
52 0.46
53 0.47
54 0.44
55 0.4
56 0.32
57 0.3
58 0.29
59 0.22
60 0.24
61 0.26
62 0.28
63 0.29
64 0.33
65 0.35
66 0.38
67 0.43
68 0.49
69 0.47
70 0.5
71 0.52
72 0.53
73 0.5
74 0.45
75 0.46
76 0.45
77 0.51
78 0.52
79 0.56
80 0.59
81 0.61
82 0.62
83 0.61
84 0.6
85 0.6
86 0.58
87 0.62
88 0.59
89 0.64
90 0.66
91 0.61
92 0.57
93 0.54
94 0.49
95 0.46
96 0.47
97 0.42
98 0.44
99 0.5
100 0.58
101 0.58
102 0.65
103 0.62
104 0.56
105 0.52
106 0.46
107 0.41
108 0.36
109 0.32
110 0.29
111 0.26
112 0.3
113 0.34
114 0.32
115 0.28
116 0.26
117 0.26
118 0.25
119 0.26
120 0.22
121 0.18
122 0.2
123 0.19
124 0.2
125 0.19
126 0.19
127 0.18
128 0.18
129 0.19
130 0.18
131 0.19
132 0.18
133 0.18
134 0.16
135 0.13
136 0.13
137 0.11
138 0.1
139 0.08
140 0.07
141 0.06
142 0.09
143 0.11
144 0.11
145 0.16
146 0.19
147 0.23
148 0.27
149 0.35
150 0.36
151 0.44
152 0.48
153 0.43
154 0.42
155 0.42
156 0.38
157 0.31
158 0.29
159 0.19
160 0.2
161 0.24
162 0.24
163 0.23
164 0.24
165 0.23
166 0.24
167 0.25
168 0.22
169 0.19
170 0.19
171 0.17
172 0.17
173 0.17
174 0.16
175 0.13
176 0.11
177 0.1
178 0.08
179 0.08
180 0.06
181 0.09
182 0.15
183 0.17
184 0.18
185 0.18
186 0.21
187 0.21
188 0.21
189 0.2
190 0.14
191 0.14
192 0.15
193 0.15
194 0.11
195 0.11
196 0.11
197 0.13
198 0.15
199 0.14
200 0.18
201 0.2
202 0.22
203 0.25
204 0.29
205 0.34
206 0.4
207 0.48
208 0.52
209 0.6
210 0.65
211 0.69
212 0.73
213 0.68
214 0.62
215 0.58
216 0.55
217 0.52
218 0.54
219 0.54
220 0.53
221 0.52
222 0.54
223 0.51
224 0.45
225 0.41
226 0.37
227 0.35
228 0.38
229 0.44
230 0.45
231 0.49
232 0.49
233 0.46
234 0.43
235 0.39
236 0.35
237 0.32
238 0.31
239 0.29
240 0.29
241 0.27
242 0.27
243 0.25
244 0.21
245 0.17
246 0.19
247 0.21
248 0.21
249 0.22
250 0.23
251 0.22
252 0.21
253 0.19
254 0.15
255 0.1
256 0.13
257 0.11
258 0.16
259 0.17
260 0.24
261 0.3
262 0.34
263 0.42
264 0.48
265 0.53
266 0.55
267 0.62
268 0.64
269 0.64
270 0.61
271 0.55
272 0.53
273 0.5
274 0.45
275 0.4
276 0.35
277 0.31
278 0.29
279 0.27
280 0.22
281 0.24
282 0.22
283 0.2
284 0.16
285 0.16
286 0.19
287 0.23
288 0.27
289 0.26
290 0.28
291 0.3
292 0.37
293 0.42
294 0.47
295 0.47
296 0.5
297 0.56
298 0.59
299 0.65
300 0.68
301 0.71
302 0.71
303 0.74
304 0.71
305 0.72
306 0.76
307 0.8
308 0.81
309 0.82
310 0.84
311 0.84
312 0.84
313 0.83
314 0.83
315 0.82
316 0.81
317 0.81
318 0.8
319 0.82
320 0.88
321 0.89
322 0.89
323 0.89
324 0.88
325 0.87
326 0.87
327 0.88
328 0.88
329 0.88
330 0.89
331 0.88
332 0.86
333 0.82
334 0.79
335 0.73
336 0.67
337 0.59
338 0.49
339 0.39
340 0.33
341 0.33
342 0.29
343 0.25
344 0.23
345 0.27
346 0.34
347 0.38
348 0.47