Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CLY3

Protein Details
Accession A0A371CLY3    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
434-456GDDRDRRRDEQRARDRERYHRDDBasic
472-522DRDRRDSERYDDRDRRRRSRSCSSRRESWRDDPRKERRRSRERSVDYGRDEBasic
NLS Segment(s)
PositionSequence
6-22RKPAPRLPKPAARYRKG
485-526DRRRRSRSCSSRRESWRDDPRKERRRSRERSVDYGRDEKRRR
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MSSAARKPAPRLPKPAARYRKGQAPKGYDAAAAELDSDDDEVEEQQEEQDEGDVLIRDVGEEDEEDEDGLTVRRDAVGKQAKGAINVSLRDVNISKEGKVIVGGKEESGRTAAELEEDEEEEEEEEEAEEEEETSEEESESEEEQPKVQFRPVFVPKRARETIAEREALAQDSEEALKRKEAEAEERKKASHDMVAESIRRELLEKEKEEETPDVDDTDGLDPTGEFEAWRLRELARIKRDKEAELARELEREEIERRRALPEEQRLKEDMERAEQSRKEKPKGQQKFLQKYWHKGAFHQDDEVLKRHDYTESTESTVDVSLLPKVMQVRNFGKRSRTKYTHLLDQDTTAATGGFGGIGSVKAGGTSTAGGGCFLCGGPHLKKDCPQNANLPPGRTATGAPTGAGMRQWGARDGDKDDRRGSWRDSDSDRGPQGDDRDRRRDEQRARDRERYHRDDSDHVRGRDRDSQDKHDRDRRDSERYDDRDRRRRSRSCSSRRESWRDDPRKERRRSRERSVDYGRDEKRRRVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.8
4 0.74
5 0.75
6 0.71
7 0.73
8 0.72
9 0.73
10 0.72
11 0.69
12 0.69
13 0.65
14 0.61
15 0.52
16 0.43
17 0.37
18 0.28
19 0.2
20 0.15
21 0.11
22 0.1
23 0.09
24 0.09
25 0.07
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.08
33 0.1
34 0.1
35 0.09
36 0.1
37 0.09
38 0.09
39 0.11
40 0.1
41 0.09
42 0.1
43 0.09
44 0.08
45 0.09
46 0.09
47 0.08
48 0.07
49 0.08
50 0.09
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.09
61 0.1
62 0.11
63 0.2
64 0.29
65 0.29
66 0.31
67 0.38
68 0.37
69 0.38
70 0.39
71 0.33
72 0.28
73 0.28
74 0.29
75 0.24
76 0.23
77 0.24
78 0.23
79 0.2
80 0.24
81 0.24
82 0.22
83 0.21
84 0.22
85 0.19
86 0.21
87 0.22
88 0.16
89 0.19
90 0.19
91 0.18
92 0.21
93 0.21
94 0.19
95 0.17
96 0.15
97 0.11
98 0.12
99 0.11
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.1
106 0.09
107 0.1
108 0.09
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.07
127 0.09
128 0.11
129 0.14
130 0.14
131 0.15
132 0.18
133 0.19
134 0.2
135 0.23
136 0.22
137 0.21
138 0.3
139 0.37
140 0.43
141 0.47
142 0.55
143 0.53
144 0.6
145 0.6
146 0.53
147 0.48
148 0.46
149 0.49
150 0.44
151 0.42
152 0.34
153 0.34
154 0.32
155 0.29
156 0.23
157 0.14
158 0.09
159 0.09
160 0.1
161 0.11
162 0.12
163 0.11
164 0.13
165 0.14
166 0.15
167 0.18
168 0.19
169 0.27
170 0.35
171 0.42
172 0.46
173 0.46
174 0.45
175 0.42
176 0.42
177 0.34
178 0.27
179 0.22
180 0.19
181 0.21
182 0.24
183 0.23
184 0.22
185 0.21
186 0.18
187 0.16
188 0.14
189 0.13
190 0.18
191 0.24
192 0.24
193 0.27
194 0.28
195 0.29
196 0.3
197 0.28
198 0.22
199 0.17
200 0.16
201 0.13
202 0.12
203 0.11
204 0.1
205 0.1
206 0.09
207 0.06
208 0.06
209 0.05
210 0.07
211 0.07
212 0.06
213 0.05
214 0.06
215 0.1
216 0.11
217 0.12
218 0.11
219 0.11
220 0.16
221 0.21
222 0.29
223 0.33
224 0.39
225 0.4
226 0.46
227 0.48
228 0.43
229 0.44
230 0.41
231 0.34
232 0.3
233 0.31
234 0.25
235 0.24
236 0.23
237 0.19
238 0.14
239 0.14
240 0.15
241 0.16
242 0.18
243 0.19
244 0.19
245 0.21
246 0.22
247 0.23
248 0.27
249 0.33
250 0.39
251 0.39
252 0.4
253 0.39
254 0.39
255 0.38
256 0.34
257 0.26
258 0.21
259 0.22
260 0.21
261 0.25
262 0.27
263 0.29
264 0.34
265 0.39
266 0.39
267 0.44
268 0.5
269 0.55
270 0.62
271 0.64
272 0.62
273 0.67
274 0.71
275 0.69
276 0.71
277 0.63
278 0.61
279 0.62
280 0.62
281 0.52
282 0.46
283 0.51
284 0.46
285 0.44
286 0.38
287 0.33
288 0.29
289 0.3
290 0.31
291 0.24
292 0.17
293 0.17
294 0.17
295 0.17
296 0.15
297 0.18
298 0.19
299 0.18
300 0.2
301 0.19
302 0.19
303 0.18
304 0.17
305 0.12
306 0.08
307 0.07
308 0.06
309 0.07
310 0.07
311 0.07
312 0.11
313 0.13
314 0.15
315 0.2
316 0.26
317 0.34
318 0.38
319 0.39
320 0.44
321 0.5
322 0.55
323 0.59
324 0.58
325 0.55
326 0.6
327 0.61
328 0.61
329 0.57
330 0.54
331 0.44
332 0.4
333 0.36
334 0.27
335 0.23
336 0.15
337 0.11
338 0.07
339 0.06
340 0.05
341 0.03
342 0.03
343 0.03
344 0.03
345 0.03
346 0.03
347 0.04
348 0.04
349 0.04
350 0.04
351 0.04
352 0.04
353 0.05
354 0.05
355 0.06
356 0.06
357 0.06
358 0.06
359 0.06
360 0.06
361 0.06
362 0.05
363 0.06
364 0.1
365 0.12
366 0.19
367 0.22
368 0.24
369 0.29
370 0.38
371 0.46
372 0.45
373 0.46
374 0.49
375 0.51
376 0.59
377 0.57
378 0.5
379 0.43
380 0.41
381 0.39
382 0.31
383 0.26
384 0.2
385 0.21
386 0.2
387 0.18
388 0.17
389 0.16
390 0.16
391 0.15
392 0.13
393 0.09
394 0.11
395 0.12
396 0.14
397 0.16
398 0.18
399 0.2
400 0.25
401 0.34
402 0.36
403 0.39
404 0.38
405 0.4
406 0.41
407 0.44
408 0.43
409 0.42
410 0.42
411 0.43
412 0.45
413 0.48
414 0.47
415 0.49
416 0.47
417 0.39
418 0.37
419 0.35
420 0.37
421 0.4
422 0.44
423 0.45
424 0.52
425 0.55
426 0.59
427 0.63
428 0.66
429 0.66
430 0.69
431 0.73
432 0.74
433 0.78
434 0.82
435 0.82
436 0.82
437 0.83
438 0.79
439 0.75
440 0.71
441 0.67
442 0.67
443 0.68
444 0.68
445 0.67
446 0.61
447 0.61
448 0.57
449 0.59
450 0.59
451 0.57
452 0.57
453 0.54
454 0.62
455 0.66
456 0.72
457 0.75
458 0.74
459 0.75
460 0.72
461 0.76
462 0.72
463 0.71
464 0.67
465 0.66
466 0.68
467 0.68
468 0.72
469 0.71
470 0.75
471 0.75
472 0.81
473 0.83
474 0.83
475 0.85
476 0.83
477 0.85
478 0.86
479 0.87
480 0.88
481 0.86
482 0.86
483 0.87
484 0.88
485 0.84
486 0.84
487 0.84
488 0.83
489 0.85
490 0.85
491 0.86
492 0.87
493 0.9
494 0.9
495 0.9
496 0.91
497 0.9
498 0.91
499 0.91
500 0.87
501 0.87
502 0.86
503 0.83
504 0.79
505 0.8
506 0.76
507 0.75
508 0.74