Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DYA1

Protein Details
Accession A0A371DYA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-85GRNLGDRPRKRGKWRGSLPKAPGSBasic
NLS Segment(s)
PositionSequence
65-85LGDRPRKRGKWRGSLPKAPGS
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MARCKRRPVCLQPAQNLGVYTISGAPIKPVWPPRRPYSVYTHPDFVPSRSACGQFMQTASRGRNLGDRPRKRGKWRGSLPKAPGSGRLFAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.59
3 0.49
4 0.39
5 0.29
6 0.21
7 0.16
8 0.1
9 0.1
10 0.08
11 0.08
12 0.08
13 0.09
14 0.09
15 0.13
16 0.22
17 0.28
18 0.34
19 0.39
20 0.43
21 0.5
22 0.53
23 0.52
24 0.52
25 0.55
26 0.53
27 0.51
28 0.48
29 0.4
30 0.41
31 0.38
32 0.3
33 0.26
34 0.21
35 0.22
36 0.21
37 0.22
38 0.19
39 0.2
40 0.2
41 0.14
42 0.15
43 0.14
44 0.15
45 0.18
46 0.18
47 0.2
48 0.19
49 0.19
50 0.24
51 0.28
52 0.36
53 0.43
54 0.48
55 0.54
56 0.64
57 0.71
58 0.74
59 0.79
60 0.78
61 0.78
62 0.82
63 0.85
64 0.84
65 0.85
66 0.81
67 0.79
68 0.73
69 0.64
70 0.62
71 0.54