Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DGE7

Protein Details
Accession A0A371DGE7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSCLRRRRSRKNPNRIRWAENVVHydrophilic
NLS Segment(s)
PositionSequence
7-13RRRSRKN
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MPSCLRRRRSRKNPNRIRWAENVVSDVWSYEREPSFPAWHKDRSFSPAQPFSPIVLGRPASPRIITMPSPWLTSAMSPMRPIPIPVPVPLGLPIHRDLVHFTESWDVREHPSPPSLPRDLRDAAAVYGGFPATSFRLFFFPPIGSPFETEIHMATTAIESAFMNVPIPCVPHWVTVGEVLSYIHAALYRPINLAHGLALSAARDARRHRLIKRDEDVWSNIIRNVDLFPAITVPPGVQTWARPSLYFIGLESWMTSDGFQFVVLFGPLPRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.91
4 0.85
5 0.81
6 0.78
7 0.71
8 0.61
9 0.53
10 0.42
11 0.37
12 0.31
13 0.24
14 0.17
15 0.14
16 0.14
17 0.17
18 0.18
19 0.17
20 0.2
21 0.22
22 0.3
23 0.35
24 0.41
25 0.4
26 0.47
27 0.48
28 0.5
29 0.5
30 0.48
31 0.47
32 0.46
33 0.49
34 0.47
35 0.46
36 0.46
37 0.44
38 0.39
39 0.37
40 0.32
41 0.24
42 0.22
43 0.22
44 0.2
45 0.24
46 0.24
47 0.22
48 0.22
49 0.21
50 0.2
51 0.23
52 0.22
53 0.2
54 0.24
55 0.24
56 0.25
57 0.24
58 0.22
59 0.18
60 0.18
61 0.21
62 0.18
63 0.18
64 0.18
65 0.19
66 0.2
67 0.2
68 0.21
69 0.16
70 0.18
71 0.19
72 0.19
73 0.21
74 0.19
75 0.19
76 0.2
77 0.2
78 0.15
79 0.16
80 0.17
81 0.16
82 0.16
83 0.16
84 0.16
85 0.17
86 0.18
87 0.15
88 0.15
89 0.18
90 0.18
91 0.19
92 0.19
93 0.17
94 0.18
95 0.21
96 0.21
97 0.17
98 0.2
99 0.2
100 0.21
101 0.25
102 0.27
103 0.25
104 0.25
105 0.28
106 0.27
107 0.26
108 0.24
109 0.19
110 0.15
111 0.15
112 0.13
113 0.08
114 0.07
115 0.07
116 0.05
117 0.04
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.08
124 0.09
125 0.09
126 0.1
127 0.09
128 0.09
129 0.11
130 0.13
131 0.11
132 0.13
133 0.14
134 0.13
135 0.14
136 0.13
137 0.11
138 0.1
139 0.1
140 0.09
141 0.07
142 0.06
143 0.05
144 0.05
145 0.05
146 0.04
147 0.06
148 0.06
149 0.06
150 0.07
151 0.06
152 0.07
153 0.07
154 0.08
155 0.07
156 0.11
157 0.12
158 0.13
159 0.14
160 0.14
161 0.14
162 0.14
163 0.15
164 0.1
165 0.09
166 0.08
167 0.07
168 0.07
169 0.06
170 0.04
171 0.05
172 0.05
173 0.07
174 0.09
175 0.1
176 0.1
177 0.11
178 0.12
179 0.12
180 0.12
181 0.1
182 0.08
183 0.07
184 0.07
185 0.07
186 0.06
187 0.06
188 0.07
189 0.08
190 0.11
191 0.14
192 0.22
193 0.3
194 0.36
195 0.4
196 0.49
197 0.56
198 0.62
199 0.64
200 0.6
201 0.54
202 0.53
203 0.51
204 0.44
205 0.38
206 0.3
207 0.28
208 0.24
209 0.21
210 0.17
211 0.16
212 0.14
213 0.12
214 0.11
215 0.09
216 0.1
217 0.1
218 0.1
219 0.09
220 0.08
221 0.09
222 0.09
223 0.11
224 0.1
225 0.13
226 0.18
227 0.25
228 0.26
229 0.24
230 0.27
231 0.29
232 0.3
233 0.28
234 0.23
235 0.19
236 0.19
237 0.19
238 0.16
239 0.13
240 0.12
241 0.12
242 0.11
243 0.09
244 0.1
245 0.1
246 0.09
247 0.08
248 0.07
249 0.09
250 0.09
251 0.09
252 0.08