Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DCV5

Protein Details
Accession A0A371DCV5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
159-180RDKWGERKKLQADIRRKRKEFWBasic
NLS Segment(s)
PositionSequence
141-178RADRKKVVAKVEEAHAANRDKWGERKKLQADIRRKRKE
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MKPRLSLPSPLRFTRSYATRLPERPPARAPDPLRNNPHAVYKDLPENVTFIHRPPPTAPSPLSYTTSPASPLLQPSAAPVDGPLPPTLRKDKGEKPPVSEEDIARIRQLRREDPETWTRGRLAAEFNCTQWFVGKITSLKRADRKKVVAKVEEAHAANRDKWGERKKLQADIRRKRKEFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.42
4 0.42
5 0.45
6 0.48
7 0.51
8 0.51
9 0.54
10 0.52
11 0.52
12 0.52
13 0.52
14 0.48
15 0.54
16 0.54
17 0.54
18 0.61
19 0.64
20 0.66
21 0.62
22 0.62
23 0.54
24 0.57
25 0.48
26 0.43
27 0.36
28 0.32
29 0.34
30 0.32
31 0.31
32 0.24
33 0.23
34 0.2
35 0.22
36 0.2
37 0.15
38 0.22
39 0.21
40 0.23
41 0.24
42 0.28
43 0.27
44 0.3
45 0.3
46 0.24
47 0.28
48 0.29
49 0.3
50 0.25
51 0.25
52 0.21
53 0.21
54 0.19
55 0.16
56 0.15
57 0.12
58 0.13
59 0.12
60 0.12
61 0.11
62 0.11
63 0.12
64 0.1
65 0.09
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.09
72 0.11
73 0.14
74 0.18
75 0.19
76 0.21
77 0.26
78 0.33
79 0.42
80 0.5
81 0.49
82 0.49
83 0.52
84 0.52
85 0.5
86 0.44
87 0.34
88 0.3
89 0.32
90 0.27
91 0.22
92 0.24
93 0.2
94 0.23
95 0.27
96 0.26
97 0.3
98 0.35
99 0.36
100 0.38
101 0.44
102 0.43
103 0.41
104 0.37
105 0.32
106 0.28
107 0.27
108 0.23
109 0.21
110 0.19
111 0.23
112 0.23
113 0.23
114 0.23
115 0.22
116 0.21
117 0.17
118 0.16
119 0.11
120 0.12
121 0.14
122 0.16
123 0.19
124 0.28
125 0.29
126 0.34
127 0.42
128 0.5
129 0.55
130 0.6
131 0.65
132 0.66
133 0.71
134 0.72
135 0.68
136 0.63
137 0.58
138 0.53
139 0.51
140 0.42
141 0.36
142 0.34
143 0.33
144 0.29
145 0.3
146 0.3
147 0.28
148 0.36
149 0.43
150 0.47
151 0.49
152 0.59
153 0.6
154 0.66
155 0.71
156 0.72
157 0.75
158 0.76
159 0.83
160 0.83