Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CUS1

Protein Details
Accession A0A371CUS1   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
138-171RSDIKKSRFKNGKPVSKKRKLRTKGAITPKRVEDBasic
NLS Segment(s)
PositionSequence
139-167SDIKKSRFKNGKPVSKKRKLRTKGAITPK
Subcellular Location(s) nucl 9mito 9cyto 9cyto_nucl 9cyto_mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MGRGRRKLGETKKAGQYVRAKGRILGEVRQILKTRIVNKTKDKSATLWLDPPLYHRCVYIGRRIHLILWPAGVPFRNLSTLTKAQLSKLLAALNKRGRGAVRFVDVTDEEAAAHARDVEGVIPGAYEVADIGIGHPGRSDIKKSRFKNGKPVSKKRKLRTKGAITPKRVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.64
4 0.63
5 0.66
6 0.63
7 0.55
8 0.51
9 0.54
10 0.52
11 0.47
12 0.41
13 0.37
14 0.38
15 0.39
16 0.4
17 0.38
18 0.33
19 0.36
20 0.37
21 0.38
22 0.41
23 0.46
24 0.49
25 0.57
26 0.63
27 0.63
28 0.62
29 0.57
30 0.5
31 0.52
32 0.5
33 0.43
34 0.39
35 0.34
36 0.31
37 0.29
38 0.31
39 0.27
40 0.24
41 0.22
42 0.19
43 0.19
44 0.24
45 0.26
46 0.3
47 0.32
48 0.3
49 0.33
50 0.33
51 0.32
52 0.28
53 0.27
54 0.19
55 0.14
56 0.13
57 0.11
58 0.11
59 0.11
60 0.09
61 0.08
62 0.08
63 0.09
64 0.1
65 0.11
66 0.15
67 0.17
68 0.17
69 0.2
70 0.2
71 0.18
72 0.21
73 0.21
74 0.16
75 0.15
76 0.16
77 0.14
78 0.15
79 0.21
80 0.22
81 0.23
82 0.22
83 0.22
84 0.21
85 0.22
86 0.24
87 0.2
88 0.18
89 0.17
90 0.17
91 0.18
92 0.17
93 0.17
94 0.14
95 0.12
96 0.09
97 0.09
98 0.09
99 0.07
100 0.07
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.08
120 0.08
121 0.08
122 0.09
123 0.1
124 0.14
125 0.16
126 0.23
127 0.27
128 0.37
129 0.48
130 0.51
131 0.6
132 0.66
133 0.68
134 0.73
135 0.74
136 0.75
137 0.76
138 0.84
139 0.85
140 0.85
141 0.91
142 0.91
143 0.91
144 0.88
145 0.87
146 0.87
147 0.87
148 0.86
149 0.87
150 0.86
151 0.82