Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CJS7

Protein Details
Accession A0A371CJS7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-35DIAPSAKKRKLQRACDYCRRKKSKCDGPEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSSADEDIAPSAKKRKLQRACDYCRRKKSKCDGPEMPDHRCSNCQARRIECTYKEPHRGNYPSSYARTLESRLERMEKLMNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.49
3 0.56
4 0.66
5 0.74
6 0.77
7 0.82
8 0.86
9 0.88
10 0.87
11 0.88
12 0.86
13 0.8
14 0.8
15 0.81
16 0.8
17 0.77
18 0.77
19 0.72
20 0.68
21 0.73
22 0.67
23 0.6
24 0.56
25 0.5
26 0.42
27 0.37
28 0.35
29 0.35
30 0.35
31 0.38
32 0.36
33 0.38
34 0.42
35 0.46
36 0.49
37 0.42
38 0.44
39 0.45
40 0.48
41 0.54
42 0.51
43 0.5
44 0.53
45 0.54
46 0.51
47 0.48
48 0.47
49 0.44
50 0.44
51 0.42
52 0.34
53 0.33
54 0.33
55 0.3
56 0.32
57 0.32
58 0.32
59 0.34
60 0.37
61 0.36
62 0.36