Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DI17

Protein Details
Accession A0A371DI17    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-37LPPTTTASRRCTRKRPSKPTVHSAPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAACKGVIDHRLPPTTTASRRCTRKRPSKPTVHSAPGSSSSWLIDSRSYSQRPRTDQCLIRTWALSALRTTQMGNARTRMALLRLGPFSSPLAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.44
4 0.46
5 0.48
6 0.52
7 0.61
8 0.67
9 0.7
10 0.72
11 0.77
12 0.81
13 0.84
14 0.86
15 0.87
16 0.86
17 0.85
18 0.81
19 0.75
20 0.65
21 0.56
22 0.48
23 0.41
24 0.35
25 0.27
26 0.2
27 0.15
28 0.14
29 0.13
30 0.12
31 0.09
32 0.1
33 0.13
34 0.18
35 0.21
36 0.23
37 0.3
38 0.34
39 0.39
40 0.41
41 0.43
42 0.45
43 0.48
44 0.49
45 0.49
46 0.46
47 0.42
48 0.39
49 0.33
50 0.3
51 0.26
52 0.22
53 0.17
54 0.17
55 0.17
56 0.17
57 0.17
58 0.17
59 0.22
60 0.25
61 0.27
62 0.26
63 0.26
64 0.26
65 0.27
66 0.24
67 0.2
68 0.2
69 0.2
70 0.23
71 0.23
72 0.24
73 0.23
74 0.23