Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DR47

Protein Details
Accession A0A371DR47    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-44NTKGQEYQPSQRKRKRKHGFLTRKRSVNGHydrophilic
NLS Segment(s)
PositionSequence
27-56RKRKRKHGFLTRKRSVNGRKMLARRRAKGR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 5.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences SIASSVFSPLLQVRHNTKGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRRAKGRLFVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.33
4 0.33
5 0.38
6 0.39
7 0.44
8 0.42
9 0.45
10 0.51
11 0.59
12 0.66
13 0.66
14 0.73
15 0.72
16 0.8
17 0.81
18 0.82
19 0.83
20 0.84
21 0.88
22 0.89
23 0.9
24 0.87
25 0.81
26 0.73
27 0.72
28 0.69
29 0.67
30 0.64
31 0.6
32 0.61
33 0.65
34 0.73
35 0.74
36 0.74
37 0.73
38 0.74
39 0.77
40 0.74
41 0.75