Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1DEN3

Protein Details
Accession A1DEN3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-43PDASRTPGKWRHPRLNEVVRRQNAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012578  Nucl_pore_cmplx  
Gene Ontology GO:0016020  C:membrane  
KEGG nfi:NFIA_077800  -  
Pfam View protein in Pfam  
PF08058  NPCC  
Amino Acid Sequences MASQSAPSTPRAVSVLAPVPDASRTPGKWRHPRLNEVVRRQNAGTFGDRNIRKLVWNGAALIATWVFGNTVKSYSLRLQNLGQYPAYPDLALHVVQLILALNILVALYPLFRPKDDLSDIPLTPTQRSLLGLDPSATPPLTPGTTYITPPRYRLSASRTATPASKGASSPLSGSAGLSGRRLSSGASFSPSTSPLLYKAVSNGGKESGRRPSFGSSSTFSRSSLFGESSIGPASPSPVGGKRANLGLSNKWLYERSRRLSASNGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.24
4 0.25
5 0.23
6 0.22
7 0.22
8 0.22
9 0.21
10 0.2
11 0.22
12 0.29
13 0.38
14 0.47
15 0.56
16 0.65
17 0.71
18 0.72
19 0.79
20 0.8
21 0.82
22 0.81
23 0.81
24 0.81
25 0.73
26 0.7
27 0.62
28 0.55
29 0.47
30 0.41
31 0.36
32 0.28
33 0.28
34 0.33
35 0.33
36 0.33
37 0.33
38 0.3
39 0.28
40 0.29
41 0.32
42 0.27
43 0.27
44 0.25
45 0.23
46 0.22
47 0.2
48 0.18
49 0.12
50 0.08
51 0.07
52 0.06
53 0.05
54 0.06
55 0.08
56 0.08
57 0.09
58 0.1
59 0.11
60 0.14
61 0.19
62 0.25
63 0.25
64 0.26
65 0.27
66 0.32
67 0.34
68 0.33
69 0.28
70 0.21
71 0.22
72 0.22
73 0.2
74 0.14
75 0.11
76 0.1
77 0.12
78 0.11
79 0.09
80 0.07
81 0.07
82 0.06
83 0.07
84 0.05
85 0.03
86 0.03
87 0.03
88 0.02
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.07
97 0.07
98 0.08
99 0.12
100 0.12
101 0.17
102 0.19
103 0.19
104 0.21
105 0.24
106 0.24
107 0.22
108 0.23
109 0.2
110 0.17
111 0.17
112 0.13
113 0.1
114 0.11
115 0.11
116 0.12
117 0.12
118 0.12
119 0.12
120 0.12
121 0.12
122 0.12
123 0.1
124 0.07
125 0.07
126 0.08
127 0.08
128 0.07
129 0.08
130 0.12
131 0.13
132 0.14
133 0.18
134 0.22
135 0.23
136 0.24
137 0.25
138 0.21
139 0.22
140 0.25
141 0.26
142 0.31
143 0.32
144 0.34
145 0.34
146 0.34
147 0.34
148 0.31
149 0.26
150 0.19
151 0.18
152 0.14
153 0.14
154 0.14
155 0.14
156 0.13
157 0.12
158 0.12
159 0.11
160 0.11
161 0.11
162 0.12
163 0.12
164 0.12
165 0.11
166 0.1
167 0.1
168 0.11
169 0.09
170 0.09
171 0.12
172 0.12
173 0.15
174 0.15
175 0.15
176 0.17
177 0.17
178 0.16
179 0.14
180 0.14
181 0.13
182 0.15
183 0.15
184 0.13
185 0.14
186 0.2
187 0.21
188 0.22
189 0.21
190 0.22
191 0.24
192 0.25
193 0.28
194 0.3
195 0.3
196 0.31
197 0.32
198 0.33
199 0.34
200 0.35
201 0.35
202 0.28
203 0.31
204 0.35
205 0.33
206 0.28
207 0.27
208 0.25
209 0.24
210 0.23
211 0.2
212 0.15
213 0.17
214 0.17
215 0.17
216 0.17
217 0.15
218 0.12
219 0.11
220 0.13
221 0.11
222 0.11
223 0.13
224 0.16
225 0.22
226 0.24
227 0.26
228 0.26
229 0.3
230 0.31
231 0.32
232 0.32
233 0.31
234 0.37
235 0.37
236 0.36
237 0.34
238 0.36
239 0.36
240 0.42
241 0.47
242 0.46
243 0.52
244 0.53
245 0.53
246 0.57