Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D7H9

Protein Details
Accession A1D7H9   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-49AEEDRVREKRKRRKTENMMEDABasic
NLS Segment(s)
PositionSequence
34-41REKRKRRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
KEGG nfi:NFIA_068420  -  
Amino Acid Sequences MRVTRVTEEPRGRIQAQTETGGQRELGAEEDRVREKRKRRKTENMMEDAARGIRSREGKEGRDEGSTALAITKGYSDMNPVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.36
4 0.35
5 0.32
6 0.28
7 0.28
8 0.26
9 0.22
10 0.16
11 0.14
12 0.11
13 0.11
14 0.1
15 0.1
16 0.11
17 0.14
18 0.17
19 0.19
20 0.23
21 0.27
22 0.36
23 0.46
24 0.56
25 0.63
26 0.69
27 0.77
28 0.83
29 0.87
30 0.85
31 0.79
32 0.7
33 0.6
34 0.51
35 0.41
36 0.31
37 0.21
38 0.13
39 0.09
40 0.12
41 0.16
42 0.17
43 0.25
44 0.3
45 0.32
46 0.37
47 0.4
48 0.37
49 0.35
50 0.33
51 0.25
52 0.22
53 0.2
54 0.14
55 0.12
56 0.1
57 0.08
58 0.08
59 0.08
60 0.07
61 0.09
62 0.09