Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371CYU1

Protein Details
Accession A0A371CYU1    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-85AIKKDAKEKKKPYVNPDRVKBasic
NLS Segment(s)
PositionSequence
69-76KDAKEKKK
129-166KKQEAERAKLAKAKKVQENVDKAREQNARRKLDKIQSR
171-182GKPARSEWNKPK
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MTDNAPAEQAASNSLGLDLEALKIKDDLDSGSADAKDESASKEDTTKPPEGSADAKGEGDAKDESAIKKDAKEKKKPYVNPDRVKTGGTQREKLSEEELKERMVRIREQNQKIKQRRQDVQADEDEYKKKQEAERAKLAKAKKVQENVDKAREQNARRKLDKIQSREWDSGKPARSEWNKPKRDEPGEDERKPQQSIGICGAVRGGGRGGGRGRGGGGGLTSPTSEKKEQDATLTATTSTETPAPAETTPASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.08
4 0.09
5 0.07
6 0.08
7 0.11
8 0.11
9 0.12
10 0.12
11 0.13
12 0.13
13 0.13
14 0.12
15 0.1
16 0.12
17 0.11
18 0.15
19 0.14
20 0.14
21 0.14
22 0.13
23 0.12
24 0.12
25 0.14
26 0.13
27 0.15
28 0.15
29 0.19
30 0.24
31 0.29
32 0.33
33 0.35
34 0.33
35 0.33
36 0.33
37 0.32
38 0.29
39 0.27
40 0.24
41 0.21
42 0.2
43 0.19
44 0.2
45 0.17
46 0.17
47 0.13
48 0.11
49 0.11
50 0.14
51 0.14
52 0.16
53 0.19
54 0.18
55 0.21
56 0.3
57 0.38
58 0.45
59 0.54
60 0.59
61 0.66
62 0.74
63 0.76
64 0.77
65 0.79
66 0.8
67 0.79
68 0.75
69 0.71
70 0.62
71 0.57
72 0.5
73 0.48
74 0.46
75 0.42
76 0.42
77 0.37
78 0.41
79 0.42
80 0.4
81 0.35
82 0.3
83 0.28
84 0.28
85 0.28
86 0.25
87 0.23
88 0.23
89 0.22
90 0.21
91 0.23
92 0.25
93 0.34
94 0.42
95 0.49
96 0.57
97 0.61
98 0.69
99 0.73
100 0.75
101 0.73
102 0.71
103 0.7
104 0.67
105 0.66
106 0.59
107 0.55
108 0.49
109 0.44
110 0.37
111 0.34
112 0.3
113 0.22
114 0.21
115 0.17
116 0.17
117 0.17
118 0.24
119 0.31
120 0.35
121 0.44
122 0.46
123 0.47
124 0.49
125 0.48
126 0.46
127 0.43
128 0.43
129 0.39
130 0.42
131 0.46
132 0.49
133 0.56
134 0.55
135 0.54
136 0.5
137 0.44
138 0.46
139 0.47
140 0.43
141 0.43
142 0.48
143 0.49
144 0.5
145 0.52
146 0.51
147 0.54
148 0.58
149 0.56
150 0.55
151 0.55
152 0.59
153 0.6
154 0.55
155 0.49
156 0.46
157 0.46
158 0.41
159 0.35
160 0.3
161 0.35
162 0.39
163 0.46
164 0.52
165 0.57
166 0.6
167 0.61
168 0.67
169 0.67
170 0.68
171 0.64
172 0.6
173 0.6
174 0.63
175 0.62
176 0.6
177 0.57
178 0.55
179 0.5
180 0.43
181 0.37
182 0.31
183 0.32
184 0.32
185 0.3
186 0.26
187 0.25
188 0.25
189 0.21
190 0.17
191 0.14
192 0.11
193 0.09
194 0.09
195 0.13
196 0.14
197 0.16
198 0.17
199 0.16
200 0.17
201 0.14
202 0.14
203 0.11
204 0.1
205 0.08
206 0.08
207 0.08
208 0.08
209 0.09
210 0.12
211 0.17
212 0.2
213 0.21
214 0.26
215 0.32
216 0.33
217 0.35
218 0.36
219 0.36
220 0.35
221 0.34
222 0.29
223 0.23
224 0.22
225 0.18
226 0.16
227 0.13
228 0.11
229 0.11
230 0.13
231 0.16
232 0.15
233 0.18