Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CPF6

Protein Details
Accession A0A371CPF6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-55AVRNNRPWKTSPKKPRRSGSQSKRERTKNHydrophilic
NLS Segment(s)
PositionSequence
32-62RPWKTSPKKPRRSGSQSKRERTKNGGRRKHK
90-100RRSPGKRRMKS
107-116TPPKKRRVAK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MAMVAPGLHERFWHRVALNRIIELEWAVRNNRPWKTSPKKPRRSGSQSKRERTKNGGRRKHKTNSECDAVPEEGEEGEDDASGKENAEVRRSPGKRRMKSEDEETATPPKKRRVAKAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.38
4 0.45
5 0.42
6 0.38
7 0.37
8 0.33
9 0.32
10 0.25
11 0.21
12 0.14
13 0.14
14 0.15
15 0.17
16 0.23
17 0.3
18 0.33
19 0.34
20 0.36
21 0.44
22 0.52
23 0.6
24 0.65
25 0.69
26 0.76
27 0.81
28 0.85
29 0.85
30 0.86
31 0.86
32 0.86
33 0.85
34 0.84
35 0.83
36 0.84
37 0.79
38 0.73
39 0.7
40 0.7
41 0.68
42 0.69
43 0.71
44 0.71
45 0.73
46 0.76
47 0.77
48 0.75
49 0.71
50 0.68
51 0.64
52 0.59
53 0.52
54 0.46
55 0.4
56 0.32
57 0.26
58 0.18
59 0.13
60 0.09
61 0.09
62 0.07
63 0.05
64 0.04
65 0.04
66 0.05
67 0.04
68 0.06
69 0.06
70 0.06
71 0.07
72 0.12
73 0.14
74 0.18
75 0.19
76 0.22
77 0.32
78 0.35
79 0.41
80 0.46
81 0.56
82 0.59
83 0.67
84 0.71
85 0.68
86 0.72
87 0.71
88 0.71
89 0.66
90 0.6
91 0.55
92 0.56
93 0.54
94 0.53
95 0.52
96 0.51
97 0.54
98 0.59
99 0.66