Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CM47

Protein Details
Accession A0A371CM47    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-61AAPSTCTRTWKRRKTIRHTPSSRPPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MAAVGLQVKTGKAEDEPSITVPWTVSITGKRHVFCAAPSTCTRTWKRRKTIRHTPSSRPPLLHTVPLRHLRSHPETSATTAGDERTQRSGRAECICLFFDPQNVKLRYSTGSLHSRSVGIHHVCCPFHSRAMGRYQYTVQSLAHWTGSTEISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.2
4 0.21
5 0.21
6 0.2
7 0.19
8 0.16
9 0.15
10 0.13
11 0.12
12 0.12
13 0.17
14 0.2
15 0.26
16 0.31
17 0.3
18 0.3
19 0.31
20 0.29
21 0.24
22 0.29
23 0.24
24 0.24
25 0.25
26 0.3
27 0.3
28 0.37
29 0.42
30 0.44
31 0.54
32 0.59
33 0.69
34 0.71
35 0.8
36 0.82
37 0.87
38 0.86
39 0.86
40 0.83
41 0.8
42 0.81
43 0.8
44 0.72
45 0.62
46 0.55
47 0.51
48 0.46
49 0.44
50 0.36
51 0.31
52 0.35
53 0.42
54 0.41
55 0.35
56 0.35
57 0.35
58 0.39
59 0.38
60 0.33
61 0.28
62 0.27
63 0.28
64 0.28
65 0.22
66 0.16
67 0.13
68 0.13
69 0.13
70 0.13
71 0.12
72 0.16
73 0.17
74 0.17
75 0.2
76 0.21
77 0.23
78 0.25
79 0.26
80 0.22
81 0.24
82 0.24
83 0.21
84 0.22
85 0.18
86 0.19
87 0.19
88 0.21
89 0.27
90 0.27
91 0.28
92 0.27
93 0.28
94 0.25
95 0.26
96 0.25
97 0.22
98 0.28
99 0.28
100 0.29
101 0.28
102 0.27
103 0.24
104 0.24
105 0.25
106 0.22
107 0.22
108 0.24
109 0.28
110 0.28
111 0.29
112 0.33
113 0.28
114 0.28
115 0.31
116 0.29
117 0.29
118 0.38
119 0.43
120 0.39
121 0.4
122 0.39
123 0.38
124 0.38
125 0.35
126 0.27
127 0.23
128 0.25
129 0.24
130 0.22
131 0.19
132 0.17
133 0.18