Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371CVM4

Protein Details
Accession A0A371CVM4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-40NHVWTWKGWKGPRKVRRHRKILRDNIQGIHydrophilic
NLS Segment(s)
PositionSequence
19-56GWKGPRKVRRHRKILRDNIQGITKPAIRRLARRGGVKR
Subcellular Location(s) mito 17, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
CDD cd00076  H4  
Amino Acid Sequences HLHPNPPQLILNHVWTWKGWKGPRKVRRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVRRLFVTYTEHAKRKTVTALDVVYALKRSGRTLYGFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.29
4 0.27
5 0.32
6 0.34
7 0.39
8 0.49
9 0.59
10 0.68
11 0.74
12 0.81
13 0.85
14 0.88
15 0.91
16 0.9
17 0.9
18 0.91
19 0.91
20 0.89
21 0.86
22 0.79
23 0.71
24 0.65
25 0.55
26 0.46
27 0.38
28 0.32
29 0.24
30 0.24
31 0.29
32 0.28
33 0.32
34 0.36
35 0.41
36 0.43
37 0.49
38 0.5
39 0.5
40 0.53
41 0.49
42 0.44
43 0.37
44 0.32
45 0.25
46 0.22
47 0.16
48 0.12
49 0.12
50 0.12
51 0.1
52 0.1
53 0.1
54 0.09
55 0.07
56 0.06
57 0.07
58 0.09
59 0.13
60 0.16
61 0.18
62 0.19
63 0.2
64 0.2
65 0.2
66 0.18
67 0.16
68 0.18
69 0.19
70 0.26
71 0.3
72 0.35
73 0.35
74 0.37
75 0.37
76 0.35
77 0.38
78 0.32
79 0.29
80 0.29
81 0.28
82 0.26
83 0.26
84 0.24
85 0.19
86 0.18
87 0.15
88 0.14
89 0.14
90 0.15
91 0.17
92 0.21
93 0.23