Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CHJ2

Protein Details
Accession A0A371CHJ2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-29RLTSARSPSKPPTKRKSKTHGKKFDTGLHydrophilic
NLS Segment(s)
PositionSequence
9-23PSKPPTKRKSKTHGK
Subcellular Location(s) plas 11, mito 5, nucl 4, cyto_mito 4, cyto 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040521  KDZ  
Pfam View protein in Pfam  
PF18758  KDZ  
Amino Acid Sequences MRLTSARSPSKPPTKRKSKTHGKKFDTGLMALVCRHGIVLFLANVDTPGEQQKFGIALIEHFMTLVPVEATVAVFYDIRCVVDRSLKLVSARSKISRVFSRSQTQSFPFCSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.86
4 0.87
5 0.88
6 0.9
7 0.91
8 0.91
9 0.86
10 0.84
11 0.78
12 0.74
13 0.65
14 0.54
15 0.46
16 0.35
17 0.29
18 0.22
19 0.19
20 0.12
21 0.09
22 0.08
23 0.06
24 0.05
25 0.05
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.06
44 0.05
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.07
65 0.09
66 0.1
67 0.11
68 0.12
69 0.18
70 0.18
71 0.2
72 0.21
73 0.22
74 0.22
75 0.27
76 0.31
77 0.29
78 0.33
79 0.33
80 0.35
81 0.37
82 0.43
83 0.45
84 0.46
85 0.47
86 0.49
87 0.55
88 0.57
89 0.58
90 0.56
91 0.53
92 0.52