Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CZJ1

Protein Details
Accession A0A371CZJ1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
167-196FGVKQRQSRSDVKKRRHRPKTNPLNLPTRFHydrophilic
NLS Segment(s)
PositionSequence
177-186DVKKRRHRPK
Subcellular Location(s) cyto 10, mito 9, nucl 5, pero 2
Family & Domain DBs
Amino Acid Sequences MPVHPRYVQPCRTLDVVVLELQVSSSKPHPPESRCCSPPPDLTVPMTGYRAPGKTLRAQYARAEMQERGELRVGMNSDLGVPDACMRWTLKSYHVNVYVGLGYELIGWPPEIPFTNLSDITGYERIHLLLSRWKTGKMYFARLPEARRLEAENHADPLKTAPAPLHFGVKQRQSRSDVKKRRHRPKTNPLNLPTRFVRDGPKSARWVSDEADSEPVPSVVELEDDRIASFDDEPRGCCFWLPMYCPPNAIAVLEMRAAGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.27
4 0.22
5 0.2
6 0.16
7 0.14
8 0.13
9 0.13
10 0.1
11 0.1
12 0.12
13 0.18
14 0.2
15 0.29
16 0.36
17 0.41
18 0.51
19 0.57
20 0.64
21 0.61
22 0.63
23 0.6
24 0.58
25 0.57
26 0.54
27 0.51
28 0.45
29 0.43
30 0.42
31 0.39
32 0.35
33 0.31
34 0.24
35 0.21
36 0.22
37 0.21
38 0.2
39 0.21
40 0.24
41 0.3
42 0.34
43 0.4
44 0.39
45 0.41
46 0.41
47 0.45
48 0.43
49 0.37
50 0.35
51 0.28
52 0.27
53 0.29
54 0.27
55 0.23
56 0.22
57 0.2
58 0.17
59 0.19
60 0.18
61 0.14
62 0.13
63 0.11
64 0.1
65 0.09
66 0.1
67 0.07
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.09
74 0.1
75 0.12
76 0.14
77 0.19
78 0.25
79 0.28
80 0.33
81 0.35
82 0.33
83 0.31
84 0.31
85 0.24
86 0.18
87 0.15
88 0.09
89 0.06
90 0.06
91 0.06
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.07
100 0.08
101 0.1
102 0.12
103 0.12
104 0.12
105 0.12
106 0.11
107 0.13
108 0.14
109 0.12
110 0.1
111 0.11
112 0.11
113 0.11
114 0.11
115 0.09
116 0.12
117 0.13
118 0.16
119 0.17
120 0.17
121 0.18
122 0.19
123 0.26
124 0.23
125 0.28
126 0.28
127 0.29
128 0.34
129 0.34
130 0.36
131 0.34
132 0.34
133 0.29
134 0.26
135 0.26
136 0.24
137 0.27
138 0.29
139 0.24
140 0.23
141 0.23
142 0.21
143 0.19
144 0.18
145 0.15
146 0.11
147 0.1
148 0.09
149 0.11
150 0.15
151 0.15
152 0.19
153 0.18
154 0.22
155 0.27
156 0.34
157 0.38
158 0.38
159 0.42
160 0.44
161 0.52
162 0.59
163 0.64
164 0.65
165 0.69
166 0.77
167 0.83
168 0.88
169 0.9
170 0.9
171 0.9
172 0.92
173 0.93
174 0.92
175 0.9
176 0.84
177 0.83
178 0.73
179 0.68
180 0.59
181 0.53
182 0.45
183 0.38
184 0.41
185 0.36
186 0.43
187 0.43
188 0.47
189 0.46
190 0.46
191 0.47
192 0.42
193 0.4
194 0.33
195 0.33
196 0.29
197 0.26
198 0.28
199 0.25
200 0.23
201 0.21
202 0.19
203 0.13
204 0.11
205 0.1
206 0.07
207 0.09
208 0.08
209 0.1
210 0.11
211 0.11
212 0.11
213 0.11
214 0.12
215 0.11
216 0.13
217 0.14
218 0.19
219 0.2
220 0.22
221 0.26
222 0.27
223 0.26
224 0.25
225 0.23
226 0.23
227 0.27
228 0.31
229 0.35
230 0.37
231 0.37
232 0.38
233 0.37
234 0.34
235 0.29
236 0.24
237 0.17
238 0.15
239 0.16
240 0.15