Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DT47

Protein Details
Accession A0A371DT47    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-112TLVARAKKTSKSKSKKKAPKSSGGSTHydrophilic
NLS Segment(s)
PositionSequence
91-107RAKKTSKSKSKKKAPKS
Subcellular Location(s) extr 20, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MVSVLTFAGVSAAHVDAERMALERRYTRAHSLGDNYVFDPRDGWETVNTTNLAYKYSNHARSDALSGSDAHNDYLDDTADSDYGNSTLVARAKKTSKSKSKKKAPKSSGGSTASNLLKGGLNKVMNSFKAFGKKEPVIITWYTGHDLLNPSCWSNPKWAPTDKSFAAALTLSGWTSKPQCFKFLELCNNPTKCVFVRVVDSCAGCAKGSKHVDLTQAAFEQLGSLSTGLMTVQMRSATDPTDDWLENLWGPKEKAND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.09
6 0.08
7 0.1
8 0.13
9 0.16
10 0.2
11 0.23
12 0.28
13 0.31
14 0.35
15 0.38
16 0.38
17 0.39
18 0.41
19 0.43
20 0.41
21 0.38
22 0.34
23 0.33
24 0.31
25 0.27
26 0.22
27 0.17
28 0.19
29 0.18
30 0.18
31 0.16
32 0.18
33 0.19
34 0.22
35 0.21
36 0.17
37 0.2
38 0.19
39 0.18
40 0.16
41 0.17
42 0.22
43 0.31
44 0.37
45 0.34
46 0.36
47 0.34
48 0.35
49 0.37
50 0.3
51 0.22
52 0.17
53 0.17
54 0.16
55 0.19
56 0.17
57 0.14
58 0.13
59 0.11
60 0.11
61 0.11
62 0.1
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.07
75 0.11
76 0.12
77 0.13
78 0.17
79 0.21
80 0.28
81 0.36
82 0.44
83 0.51
84 0.6
85 0.7
86 0.77
87 0.84
88 0.86
89 0.89
90 0.9
91 0.85
92 0.85
93 0.81
94 0.75
95 0.72
96 0.66
97 0.56
98 0.45
99 0.45
100 0.35
101 0.28
102 0.23
103 0.16
104 0.13
105 0.13
106 0.14
107 0.12
108 0.13
109 0.12
110 0.15
111 0.16
112 0.15
113 0.17
114 0.17
115 0.15
116 0.21
117 0.22
118 0.21
119 0.25
120 0.25
121 0.26
122 0.26
123 0.25
124 0.21
125 0.2
126 0.21
127 0.16
128 0.16
129 0.15
130 0.14
131 0.13
132 0.11
133 0.14
134 0.12
135 0.14
136 0.14
137 0.13
138 0.14
139 0.17
140 0.16
141 0.2
142 0.23
143 0.24
144 0.29
145 0.33
146 0.36
147 0.37
148 0.42
149 0.36
150 0.35
151 0.3
152 0.25
153 0.21
154 0.17
155 0.13
156 0.09
157 0.09
158 0.06
159 0.07
160 0.07
161 0.08
162 0.12
163 0.15
164 0.21
165 0.22
166 0.27
167 0.29
168 0.32
169 0.37
170 0.41
171 0.47
172 0.45
173 0.48
174 0.51
175 0.5
176 0.47
177 0.41
178 0.36
179 0.28
180 0.28
181 0.26
182 0.19
183 0.25
184 0.26
185 0.28
186 0.28
187 0.27
188 0.23
189 0.23
190 0.22
191 0.15
192 0.16
193 0.15
194 0.21
195 0.24
196 0.25
197 0.27
198 0.29
199 0.33
200 0.33
201 0.33
202 0.27
203 0.25
204 0.23
205 0.19
206 0.16
207 0.13
208 0.1
209 0.09
210 0.07
211 0.06
212 0.06
213 0.06
214 0.06
215 0.05
216 0.08
217 0.08
218 0.08
219 0.1
220 0.11
221 0.11
222 0.14
223 0.15
224 0.14
225 0.15
226 0.15
227 0.16
228 0.21
229 0.2
230 0.19
231 0.2
232 0.2
233 0.2
234 0.23
235 0.24
236 0.24
237 0.25