Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371CZP1

Protein Details
Accession A0A371CZP1    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
299-321HEEELLRKSRRRRWDWGRVGVEABasic
NLS Segment(s)
Subcellular Location(s) plas 19, nucl 2, cyto 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021100  N-glycosylation_EOS1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF12326  EOS1  
Amino Acid Sequences MSAPSSSPPPYSLTPPDLPPNVSSVPPPRAASSPHLRVPGTSSLASHTHSRQAVSEYARVVQRGGPTSDDEDESGADTDEGVMFRPHGVSLADSLRNRLLGKGKGRAYDEHWSRPITTAPGAMCAGETETEGEDSPRNLPTARITHSSLSRQLTSALWLVPILFQLFRLLAIVPAVFGTLWNIYHVLRPPDGLNEWRVDYSVSVLWSVLTGWQCLQLTTGLLKRWRVYYSLPAALIRLLALQAICWPATHLTLTILDHEVRPLICWAVIGTTTCCSRSVQLWVTSNIVPAPPPPGAPPHEEELLRKSRRRRWDWGRVGVEAALPAGIVYFVMAWAVVLRREFMGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.47
4 0.45
5 0.44
6 0.38
7 0.38
8 0.33
9 0.3
10 0.31
11 0.31
12 0.33
13 0.35
14 0.36
15 0.33
16 0.34
17 0.37
18 0.4
19 0.43
20 0.45
21 0.45
22 0.48
23 0.45
24 0.43
25 0.44
26 0.42
27 0.37
28 0.31
29 0.26
30 0.26
31 0.28
32 0.29
33 0.28
34 0.24
35 0.27
36 0.28
37 0.28
38 0.27
39 0.28
40 0.32
41 0.31
42 0.32
43 0.26
44 0.28
45 0.29
46 0.28
47 0.25
48 0.23
49 0.24
50 0.24
51 0.24
52 0.23
53 0.23
54 0.26
55 0.27
56 0.25
57 0.21
58 0.17
59 0.16
60 0.15
61 0.13
62 0.1
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.07
74 0.08
75 0.08
76 0.08
77 0.1
78 0.14
79 0.19
80 0.18
81 0.21
82 0.2
83 0.22
84 0.22
85 0.22
86 0.24
87 0.26
88 0.3
89 0.36
90 0.38
91 0.41
92 0.43
93 0.41
94 0.41
95 0.44
96 0.43
97 0.41
98 0.41
99 0.38
100 0.36
101 0.35
102 0.32
103 0.24
104 0.21
105 0.18
106 0.16
107 0.17
108 0.16
109 0.14
110 0.12
111 0.1
112 0.1
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.08
121 0.08
122 0.1
123 0.1
124 0.1
125 0.1
126 0.11
127 0.14
128 0.18
129 0.2
130 0.22
131 0.23
132 0.25
133 0.28
134 0.29
135 0.3
136 0.28
137 0.25
138 0.22
139 0.21
140 0.19
141 0.18
142 0.16
143 0.12
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.09
172 0.11
173 0.12
174 0.12
175 0.13
176 0.13
177 0.14
178 0.15
179 0.15
180 0.14
181 0.14
182 0.15
183 0.14
184 0.13
185 0.11
186 0.1
187 0.1
188 0.1
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.08
196 0.07
197 0.07
198 0.07
199 0.11
200 0.11
201 0.11
202 0.11
203 0.09
204 0.09
205 0.11
206 0.14
207 0.14
208 0.17
209 0.19
210 0.19
211 0.22
212 0.22
213 0.22
214 0.22
215 0.26
216 0.29
217 0.3
218 0.29
219 0.26
220 0.26
221 0.23
222 0.21
223 0.13
224 0.08
225 0.05
226 0.05
227 0.05
228 0.05
229 0.06
230 0.07
231 0.07
232 0.07
233 0.08
234 0.08
235 0.1
236 0.1
237 0.09
238 0.09
239 0.11
240 0.12
241 0.12
242 0.13
243 0.13
244 0.13
245 0.13
246 0.13
247 0.11
248 0.12
249 0.11
250 0.1
251 0.09
252 0.09
253 0.09
254 0.08
255 0.09
256 0.09
257 0.1
258 0.12
259 0.13
260 0.14
261 0.14
262 0.14
263 0.15
264 0.17
265 0.22
266 0.26
267 0.31
268 0.33
269 0.34
270 0.37
271 0.35
272 0.33
273 0.27
274 0.22
275 0.16
276 0.14
277 0.16
278 0.13
279 0.13
280 0.14
281 0.19
282 0.22
283 0.26
284 0.29
285 0.29
286 0.32
287 0.32
288 0.33
289 0.35
290 0.42
291 0.44
292 0.46
293 0.51
294 0.56
295 0.66
296 0.71
297 0.74
298 0.75
299 0.8
300 0.84
301 0.85
302 0.81
303 0.71
304 0.65
305 0.55
306 0.45
307 0.34
308 0.24
309 0.13
310 0.09
311 0.07
312 0.06
313 0.05
314 0.04
315 0.04
316 0.03
317 0.03
318 0.04
319 0.04
320 0.04
321 0.06
322 0.08
323 0.1
324 0.1
325 0.12