Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CYM3

Protein Details
Accession A0A371CYM3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-90RDDRRCCRRCSCFARCARRKGPBasic
NLS Segment(s)
PositionSequence
204-216GKRANKAERKIYR
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045318  EZH1/2-like  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Gene Ontology GO:0006338  P:chromatin remodeling  
Amino Acid Sequences MCKLASLCRVDCRDVYHHRLLLLPRKHSTIPRDEEEDYPAGPAGIERELDPYLCRHDGPCTPEICVCARDDRRCCRRCSCFARCARRKGPATSQEDARDWRKGCVCKDGICEHGCPCEESGWECSPELCIPFENKRTQGGGGGSTQKHLCQHMDIQREVQPEIIVKEGSYGMGAFVDPKKTIPKTTYLGEYVAEMFPLLRGPEGKRANKAERKIYRHRKLNYMFTDVRNDVGEEIAPITLFDAATVGNPTRFFNDSLLDKTKVNVYVGTSTVDGDRRLGMWTSKYVKKGQELLLDYGSGYWVDDGPSSDEEEFDTESVTLADEQDKDKDGSGESRTACDDDEKDNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.53
4 0.5
5 0.47
6 0.51
7 0.52
8 0.53
9 0.53
10 0.51
11 0.47
12 0.5
13 0.53
14 0.55
15 0.56
16 0.56
17 0.55
18 0.53
19 0.56
20 0.54
21 0.51
22 0.49
23 0.43
24 0.33
25 0.27
26 0.22
27 0.16
28 0.14
29 0.12
30 0.1
31 0.09
32 0.1
33 0.09
34 0.13
35 0.13
36 0.14
37 0.15
38 0.14
39 0.18
40 0.19
41 0.2
42 0.18
43 0.22
44 0.27
45 0.32
46 0.35
47 0.3
48 0.31
49 0.31
50 0.33
51 0.3
52 0.26
53 0.22
54 0.27
55 0.33
56 0.39
57 0.46
58 0.54
59 0.62
60 0.66
61 0.7
62 0.7
63 0.71
64 0.73
65 0.75
66 0.73
67 0.72
68 0.76
69 0.82
70 0.81
71 0.82
72 0.78
73 0.77
74 0.74
75 0.71
76 0.71
77 0.69
78 0.67
79 0.61
80 0.6
81 0.54
82 0.51
83 0.5
84 0.43
85 0.4
86 0.34
87 0.35
88 0.37
89 0.39
90 0.39
91 0.43
92 0.42
93 0.39
94 0.43
95 0.41
96 0.4
97 0.36
98 0.36
99 0.28
100 0.29
101 0.26
102 0.22
103 0.2
104 0.16
105 0.15
106 0.15
107 0.19
108 0.17
109 0.18
110 0.17
111 0.16
112 0.16
113 0.17
114 0.16
115 0.11
116 0.11
117 0.13
118 0.18
119 0.23
120 0.25
121 0.26
122 0.27
123 0.27
124 0.27
125 0.26
126 0.22
127 0.18
128 0.17
129 0.21
130 0.19
131 0.2
132 0.19
133 0.18
134 0.18
135 0.18
136 0.17
137 0.13
138 0.2
139 0.24
140 0.28
141 0.28
142 0.28
143 0.3
144 0.31
145 0.29
146 0.22
147 0.17
148 0.13
149 0.13
150 0.12
151 0.09
152 0.07
153 0.08
154 0.07
155 0.07
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.07
164 0.07
165 0.08
166 0.13
167 0.14
168 0.16
169 0.16
170 0.2
171 0.22
172 0.24
173 0.25
174 0.22
175 0.21
176 0.19
177 0.18
178 0.15
179 0.12
180 0.1
181 0.07
182 0.06
183 0.05
184 0.06
185 0.05
186 0.04
187 0.06
188 0.08
189 0.17
190 0.25
191 0.27
192 0.32
193 0.38
194 0.47
195 0.52
196 0.55
197 0.56
198 0.57
199 0.63
200 0.68
201 0.73
202 0.74
203 0.76
204 0.75
205 0.74
206 0.71
207 0.73
208 0.66
209 0.62
210 0.56
211 0.49
212 0.52
213 0.42
214 0.38
215 0.29
216 0.25
217 0.18
218 0.15
219 0.13
220 0.07
221 0.07
222 0.06
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.05
232 0.07
233 0.07
234 0.08
235 0.09
236 0.1
237 0.13
238 0.15
239 0.16
240 0.15
241 0.19
242 0.2
243 0.24
244 0.28
245 0.27
246 0.25
247 0.25
248 0.28
249 0.26
250 0.24
251 0.2
252 0.18
253 0.19
254 0.2
255 0.2
256 0.16
257 0.15
258 0.16
259 0.17
260 0.15
261 0.13
262 0.13
263 0.12
264 0.13
265 0.15
266 0.15
267 0.15
268 0.22
269 0.28
270 0.32
271 0.35
272 0.39
273 0.42
274 0.45
275 0.49
276 0.48
277 0.49
278 0.48
279 0.48
280 0.43
281 0.39
282 0.33
283 0.26
284 0.21
285 0.13
286 0.09
287 0.07
288 0.06
289 0.07
290 0.08
291 0.09
292 0.12
293 0.13
294 0.16
295 0.15
296 0.15
297 0.15
298 0.16
299 0.16
300 0.12
301 0.13
302 0.1
303 0.1
304 0.1
305 0.1
306 0.08
307 0.08
308 0.12
309 0.12
310 0.15
311 0.17
312 0.2
313 0.2
314 0.21
315 0.21
316 0.21
317 0.24
318 0.26
319 0.3
320 0.28
321 0.29
322 0.3
323 0.29
324 0.28
325 0.28
326 0.27