Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DUI7

Protein Details
Accession A0A371DUI7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-73VKTEPASKRKGKVRNPSPSRTRHydrophilic
NLS Segment(s)
PositionSequence
58-73SKRKGKVRNPSPSRTR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDNDDYLEGYQVMATPTWIQREKKLFASTLNKREVEEESSEQEEPLPSTSHVKTEPASKRKGKVRNPSPSRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.18
5 0.24
6 0.24
7 0.3
8 0.37
9 0.39
10 0.42
11 0.42
12 0.37
13 0.38
14 0.46
15 0.47
16 0.47
17 0.49
18 0.44
19 0.41
20 0.42
21 0.38
22 0.31
23 0.26
24 0.2
25 0.18
26 0.2
27 0.19
28 0.17
29 0.16
30 0.13
31 0.11
32 0.11
33 0.1
34 0.09
35 0.13
36 0.14
37 0.16
38 0.17
39 0.18
40 0.18
41 0.27
42 0.36
43 0.38
44 0.46
45 0.49
46 0.56
47 0.63
48 0.71
49 0.72
50 0.73
51 0.77
52 0.8
53 0.82