Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DJX4

Protein Details
Accession A0A371DJX4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-124DDEHYKPKPSKHYRAEPRAPTALHydrophilic
NLS Segment(s)
PositionSequence
45-113QAKKRDEQHPKPSKRVHWRAEAREPTGVARRDDEHYKPKPSKHWRAEARAPTGVARRDDEHYKPKPSKH
Subcellular Location(s) extr 14, mito 5, plas 5, cyto 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MNSRFILFFVTLLALALFVTANPVPANDATLVKKALKQYDARAAQAKKRDEQHPKPSKRVHWRAEAREPTGVARRDDEHYKPKPSKHWRAEARAPTGVARRDDEHYKPKPSKHYRAEPRAPTALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.04
5 0.03
6 0.07
7 0.07
8 0.08
9 0.08
10 0.08
11 0.1
12 0.1
13 0.12
14 0.1
15 0.13
16 0.14
17 0.16
18 0.18
19 0.17
20 0.2
21 0.22
22 0.25
23 0.27
24 0.27
25 0.3
26 0.37
27 0.38
28 0.38
29 0.41
30 0.39
31 0.4
32 0.45
33 0.43
34 0.38
35 0.42
36 0.48
37 0.51
38 0.57
39 0.63
40 0.67
41 0.68
42 0.71
43 0.72
44 0.72
45 0.73
46 0.73
47 0.67
48 0.66
49 0.68
50 0.66
51 0.7
52 0.65
53 0.55
54 0.47
55 0.43
56 0.35
57 0.35
58 0.31
59 0.23
60 0.21
61 0.21
62 0.23
63 0.27
64 0.3
65 0.32
66 0.35
67 0.43
68 0.46
69 0.48
70 0.55
71 0.61
72 0.67
73 0.66
74 0.71
75 0.71
76 0.74
77 0.8
78 0.76
79 0.71
80 0.63
81 0.56
82 0.48
83 0.46
84 0.42
85 0.36
86 0.31
87 0.29
88 0.3
89 0.33
90 0.35
91 0.38
92 0.39
93 0.45
94 0.46
95 0.5
96 0.58
97 0.64
98 0.7
99 0.71
100 0.77
101 0.8
102 0.86
103 0.89
104 0.85
105 0.82