Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DS92

Protein Details
Accession A0A371DS92   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-86GASGNSTRRKKPSRRMWSRADYSKSHydrophilic
NLS Segment(s)
PositionSequence
69-76RRKKPSRR
Subcellular Location(s) nucl 10, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029062  Class_I_gatase-like  
Amino Acid Sequences MVNIFESMGCRATAIPSAEEDSRRRKDFPFLVESRIQELVGEHSCSAHGEASVVVNGNAMTGASGNSTRRKKPSRRMWSRADYSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.18
5 0.2
6 0.23
7 0.26
8 0.3
9 0.35
10 0.38
11 0.38
12 0.37
13 0.43
14 0.44
15 0.45
16 0.45
17 0.4
18 0.41
19 0.42
20 0.41
21 0.36
22 0.31
23 0.26
24 0.17
25 0.16
26 0.15
27 0.13
28 0.13
29 0.1
30 0.09
31 0.09
32 0.1
33 0.1
34 0.07
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.05
51 0.07
52 0.1
53 0.19
54 0.25
55 0.3
56 0.39
57 0.49
58 0.58
59 0.67
60 0.75
61 0.78
62 0.84
63 0.86
64 0.87
65 0.87
66 0.86