Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371CLD3

Protein Details
Accession A0A371CLD3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-111VFIKSHKHTFRTRKEPKKPSAAYHydrophilic
NLS Segment(s)
PositionSequence
101-106RKEPKK
Subcellular Location(s) cyto_mito 7.666, cyto 7.5, cyto_nucl 7.333, mito 6.5, extr 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MSGSGEMASSCTFVLVYHLVQTTECAHALNVWPVGFPNGYEGEGQVRAQDNTHHSPVLDRHLLFTIVVSDRASRHCIDQALSGWTYRYVFIKSHKHTFRTRKEPKKPSAAYLKRLPAAVLDVDWSQEAAQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.13
5 0.14
6 0.14
7 0.14
8 0.16
9 0.15
10 0.15
11 0.15
12 0.12
13 0.11
14 0.12
15 0.14
16 0.15
17 0.15
18 0.13
19 0.13
20 0.12
21 0.14
22 0.13
23 0.11
24 0.1
25 0.1
26 0.11
27 0.11
28 0.11
29 0.11
30 0.12
31 0.12
32 0.11
33 0.12
34 0.11
35 0.12
36 0.14
37 0.18
38 0.21
39 0.23
40 0.21
41 0.19
42 0.21
43 0.22
44 0.24
45 0.22
46 0.17
47 0.17
48 0.18
49 0.18
50 0.16
51 0.14
52 0.11
53 0.08
54 0.09
55 0.08
56 0.08
57 0.09
58 0.11
59 0.13
60 0.11
61 0.12
62 0.14
63 0.15
64 0.15
65 0.16
66 0.16
67 0.16
68 0.16
69 0.15
70 0.13
71 0.13
72 0.13
73 0.12
74 0.12
75 0.11
76 0.13
77 0.2
78 0.29
79 0.34
80 0.43
81 0.47
82 0.5
83 0.58
84 0.66
85 0.69
86 0.71
87 0.76
88 0.78
89 0.83
90 0.88
91 0.87
92 0.87
93 0.8
94 0.76
95 0.77
96 0.73
97 0.69
98 0.68
99 0.66
100 0.57
101 0.55
102 0.47
103 0.37
104 0.33
105 0.27
106 0.19
107 0.15
108 0.13
109 0.14
110 0.14
111 0.13